Beltronics Vector 940 User manual

VECTOR 960
VECTOR 960
VECTOR 940
VECTOR 940
THE NEXT GENERATION IN DIGITAL PERFORMANCE
THE NEXT GENERATION IN DIGITAL PERFORMANCE
Operating Instructions
MOTOROLAMOTOROLA
digitaldna
TM
MOTOROLA
Model V960
Model V940
k

CONGRATULATIONS!
SOFTWARE UPGRADABLE
SHADOW TECHNOLOGY®II
Thank you for purchasing one of BEL’s VECTOR SERIES
Radar/Laser/Safety Detectors. BEL’s VECTOR SERIES
offers Driver Selectable Features, Digital Voice, Text
Messages and the best possible X, K and Super Wideband
Ka radar sensitivity available. Enjoy your new detector and
be sure to obey all laws where ever you may travel.
Remember, owning a Radar detector does not give you a
license to speed. Alerts from a Radar detector serve as an
effective reminder to check your speed. Laws vary
throughout the USA governing the use of a Radar
detector. It is your responsibility to follow these laws.
VECTOR 960 and VECTOR 940 contain Flash Technology
which provides the highest capability to be reprogrammed
as the threat of new police traffic radar monitoring
technologies emerge. Please ensure that you promptly
send in your Consumer Information card. This will ensure
you are notified about new traffic monitoring technologies
as they emerge.
VECTOR 960 and VECTOR 940 contain Shadow
Technology® II making them undetectable to the
Interceptor VG-2 Radar Detector Detector.

2
Includes 16 Driver Selectable Features
5 Operating Modes 11 General Features
Normal Mode
Modifications Mode
Quick-Start X Band (10.525 GHz) On/Off
Tech Mode
Voltage Meter Mode K Band (24.125 GHz) On/Off
Super Wideband Ka (33.4-36.0)
AccuSweep™
Operating modes are
Selected using PWR Button
See page 00.
AutoMute On/Off
Radar/Laser Digital Voice
Prompts On/Off
Safety Warning System™On/Off
Safety Warning System Digital
Voice or Tone
Audio/Visual Scroll Rate
Fast/Slow
Inverted Display Option
AutoScan
General Features selected by pressing
.
VECTOR 960 and VECTOR 940 provide Driver Selectable
Features. Driver Selectable Features allow you to “customize” how
alerts will be presented to you.
4Operating Modes
VECTOR 960
3Operating Modes
VECTOR 940
1. NORMAL Mode
A lengthy power up test
sequence; text messages identify
alerts received, i.e. “XXBBaanndd”.
2. MODIFICATIONS Mode
Full Power-up test sequence;
presents ONLY those General
Selectable Features which you
have altered from factory pre-set.
Text messages identify alerts received.
3. QUICK START Mode
No test sequence; unit immediately
shows last used traveling
mode:“AAuuttooSSccaann™”,
“HHiigghhwwaayy”, “ CCiittyyXX”
“CCiittyy
AALLLL
”, Text messages
identify alerts received.
4. TECH Mode (V960 only)
Full Power-up text sequence.
Text messages identify band received
followed by ACTUAL police traffic
radar or Laser frequency, i.e.,
“2244..115500” to confirm K band.
7General Selectable Features
VECTOR 960
6General Selectable Features
VECTOR 940
1. AutoMute ON or OFF
2. Radar/Laser Digital
Voice or Tone
(Model V960)
2. Radar/Laser/SWS™
Digital Voice or Tone
(Model V940)
3. Safety Warning System™
ON/OFF
4. Safety Warning System™
Digital Voice ON or OFF
(Model V960)
5. Audio/Visual Scroll Rate:
FAST or SLOW
6. Inverted Display Option
ON or OFF
7. AutoScan™, “Highway”,
“City X”or “City ALL.”
Operating Modes are
selected using the PWR button.
( see page 5 .)
General Selectable Features are
accessed by pressing the PWR and
CTY buttons simultaneously, when
the unit is OFF. (see page 14.)
Note: for convenience AutoScan
™
is accessed using the CTY button.
(see page 9 .)

33
Table of Contents
Profile of Features . . . . . . . . . . . . . . . . . . . . . . . . . 4
Getting Started . . . . . . . . . . . . . . . . . . . . . . . . . . . 5
kPower-Up Test Sequence/Start-Up Mode . . . . 5
kTutorial Mode . . . . . . . . . . . . . . . . . . . . . . . . . 7
kSet and Forget Memory . . . . . . . . . . . . . . . . . . 8
kReset to Factory Settings . . . . . . . . . . . . . . . . . 8
kDRK (Bright/Dim/Dark) Button . . . . . . . . . . . 8
kAUD (Auto-Mute/Volume Control) Button . . . 9
kCTY (City/Highway) Button . . . . . . . . . . . . . . 9
Selectable Features . . . . . . . . . . . . . . . . . . . . . . . . 11
kEntering Selectable Features Mode . . . . . . . . . 14
Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14
kGeneral Guidelines . . . . . . . . . . . . . . . . . . . . . . 14
Understanding Radar, Laser and SWS™. . . . . . . . . . 17
Interpretation of Alerts . . . . . . . . . . . . . . . . . . . . . 18
kRadar Alerts . . . . . . . . . . . . . . . . . . . . . . . . . . . 18
kInstant-On/Pulsed Radar Alert . . . . . . . . . . . . 21
kTypical False Alert (Radar) . . . . . . . . . . . . . . . . 21
kLaser Alerts . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
kSafety Warning System®(SWS™) Alerts . . . . . . 22
Performance Verification . . . . . . . . . . . . . . . . . . . . 24
kConditions That Affect Radar Alerts . . . . . . . . 24
Conditions That Affect Laser Alerts . . . . . . . . 24
Troubleshooting . . . . . . . . . . . . . . . . . . . . . . . . . . . 25
Limited Warranty . . . . . . . . . . . . . . . . . . . . . . . . . . 26
Service . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27
kWarranty Service . . . . . . . . . . . . . . . . . . . . . . . 27
Post Warranty Service . . . . . . . . . . . . . . . . . . . 28
Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29
k
k

Profile of Features
1. PWR (Power/Start-Up Mode) Button:
pressing and holding PWR will turn the unit on.
Continuing to press the PWR button will scroll
through the start-up mode options: NNOORRMMAALL,,MMOODDSS
(Modifications), QQ--SSTTAARRTT(Quick Start), TTEECCHHMMOODDEE
(Model V960 only) plus TTUUTTOORRIIAALLMMOODDEE.
2. Text Message Display:communicates all mode
selections (i.e. DDIIMM, DDAARRKK, CCIITTYY, HHIIGGHHWWAAYYand
AAUUTTOOMMUUTTEE)and confirms Radar band and signal
strength, presence of Laser and SWS™messages
received.
3. DRK (Bright/Dim/Dark) Button: provides bright,
dark and fully adjustable dim settings of the Text
Display for discreet night travel. Audio alerts are not
affected.
4. CTY (City/Highway/AutoScan) Button: choose
between Autoscan™, Highway, City X or City ALL
(X/K/Ka) filtration modes.
5. AUD (Auto-Mute/Volume Control) Button:
provides manual muting of all Radar and sws™alerts.
Pressing and holding the AUD button will change the
audio level.
6. Antenna Opening: Radar and sws™signals are
received by a patented diecast antenna with
integrated transition to microstrip mixer.
4
7
24
1
9
6
3
5
8
Note: Model V960 pictured

5
7. Laser Optical Sensors: collect Laser signals from in
front and behind.
8. Audio Alert Speaker: all audible alerts and Digital
Voice Messages are emitted from this location.
9. Power Jack: using the straight or coiled cord,
VECTOR 960 and VECTOR 940 operate in any vehicle
with a 13.8 volt DC negative ground system (10.5 volt to
15.5 volt range) .
Getting Started
Power-Up Test Sequence/Start-Up Mode
Using the supplied straight or coiled power cord,
place the end with the “elbow” shaped jack into the
receptacle on the side of the detector; the opposite
end of the cord connects to the cigarette barrel. Plug
the cigarette barrel into your vehicle’s cigarette plug, or the
secondary receptacle if your vehicle is so equipped. Press
the PWR button to turn the unit ON. Depending upon the
Operating Mode selected, the power up test sequence and
confirmation of Radar/Laser/SWS™alerts will be relayed to
you as follows:
NNOORRMMAALL(Factory Pre-Set Mode)
A lengthy, power up test sequence that displays audio
and text messages for Laser, Ka, K, X and Safety
Warning System®(SWS™) followed by the status of
the General Selectable Features each time the unit is
turned on. When complete, unit is ready for
operation and will display Radar, Laser and SWS™
messages when signals are detected. Normal Mode is
recommended when first using your VECTOR 985.
MMOODDSS(Modifications Mode)
Presents audio and text messages for Laser, Ka, K, X
and Safety Warning System®(SWS™), followed by
ONLY those General Selectable Features which have
been modified by the user from their Factory pre-set
5
k
k
k

state each time unit is turned on. Unit is ready for
operation and will display Radar, Laser and SWS™
messages when signals are detected.
QQ--SSTTAARRTT(Quick-Start Mode)
Unit will bypass the power up test sequence and will
display the last selected traveling mode:“
AAuuttooSSccaann™
”
(factory default) “
HHiigghhwwaayy
”, “
CCiittyyXX
” or “
CCiittyy AALLLL”.
Q-Start is recommended when you are comfortable
with the detector and do not require a rundown of
sample messages. Unit is ready for operation and will
display Radar, Laser and SWS™messages when
signals are detected.
TTEECCHHMODE (VECTOR 960 only)
Presents audio and text messages followed by the
display of the ACTUAL frequency of the received
radar bandwidth and Laser. Unit is ready for
operation and will display Radar, Laser and SWS™
messages – including actual frequencies – when
signals are detected.
Sample alerts while operating in Tech Mode:
Laser Alert: “LLAASSEERR990000NNMM”
X Band Alert: “XXBBAANNDD” followed by “1100..552255”
K Band Alert: “KKBBAANNDD” followed by “2244..115500”
Ka Band Alert: “KKaaBBAANNDD” followed by any
frequency between 3333..44––3366..00GGHHzz.
6
k
k

7
Whichever Operating mode you select, VECTOR 960 and
VECTOR 940 will be in standby mode and ready to
detect traffic Radar, Laser and SWS™signals. The display
will show “
AAuuttooSSccaann™
” (factory pre-set which is suitable
for ALL driving conditions, unless you change this to
“
HHiigghhwwaayy
”, “
CCiittyyXX
”, or “
CCiittyy AALLLL” (see page 9).
TUTORIAL MODE
The Tutorial Mode allows you to become more familiar
with all audible and visual alerts. The message
“
TTUUTTOORRIIAALL
” appears in the display followed by the
audio and corresponding Text Message for “
LLAASSEERR
” ,
“
KKaaAAUUDDIIOO
” , “
KKAAUUDDIIOO
” , “
XXAAUUDDIIOO
” , sample Radar
alert and “
SSAAFFEETTYYWWAARRNNIINNGGSSYYSSTTEEMMSSAAMMPPLLEEAALLEERRTTSS
” .
Three sample SWS™messages are then presented in
the display along with the corresponding Digital Voice
Messages:
Sample 1
“
AACCCCIIDDEENNTTAAHHEEAADD
”
Sample 2 “
HHIIGGHHWWAAYYWWOORRKKCCRREEWWAAHHEEAADD
”
Sample 3 “
PPOOLLIICCEEIINNPPUURRSSUUIITT
”
You can access the complete list of SWS™messages
by pressing the AUD button. “
MMSSGG11
” will appear in the
display once AUD is pressed. Pressing the AUD button
a second time will allow you to listen to the SWS™
message while viewing it in the display. (to move
forward in the list, press the CTY button; to move
backward in the list, press the DRK button). Continue
the steps above to play all 60 SWS™ messages.
7
k
Note: sample radar and SWS™messages are random.
Presentation of alerts will differ than what is printed based
on operation mode selected. Tutorial Mode will cycle
continuously until PWR is pressed to exit this mode.
Note: VECTOR 940 provides Digital Voice and Text Messages for the FIVE SWS
™
categories only and NOT the individual messages for each category. For example,
“
MMSSGG11
” will play the category,
HHiigghhwwaayyCCoonnssttrruuccttiioonn//MMaaiinntteennaannccee
. This
heading will play for all 11 messages. Refer to the enclosed card for the other
category messages.

To exit Tutorial Mode, press the PWR button and
your unit will be on and ready to receive signals.
Set and Forget Memory
Any time your unit is turned off or unplugged from the
cigarette lighter socket, all feature settings you have
selected are retained in the unit’s memory. Set and
Forget Memory eliminates the need to reset your
preferred feature settings each time your unit is
turned off and then back on.
Reset to Factory Settings
You can reset your unit to factory settings for Start-Up
mode, volume, DRK, AUD, CTY and General Selectable
Features. To reset, press and hold the CTY button until
the display shows “RREESSEETT“.Two “beeps“ will sound and
your unit will cycle through the NNOORRMMAALLStart-Up
Mode.
DRK (Bright/Dim/Dark) Button
The DRK button allows selection of a bright, fully
adjustable dim or dark mode. Your unit is factory
preset to full bright display. To engage dim mode,
press and hold the DRK button. The display will
cycle through various levels of dim illumination.
Release the button at your chosen level. To engage
dark mode, press the DRK button a second time. A
single “beep” coupled with the brief illumination of
“
DDAARRKK
” on the display confirms your selection.
You’ll notice an “
AAss
” (AutoScan™), “
HH
” (Highway
mode), “
CCxx
” (City mode) or “
CCAA
” (City ALL) remains
dim to confirm your unit is receiving power. To
return to a full bright setting, press the DRK button
a third time; two “beeps” confirm this selection. Use of
the DRK button does not affect audio alerts.
Important—if you press the the DRK button and do not
receive audible confirmation, the audio level has been set
too low.
8
k
k
k

9
AUD (Auto-Mute/Volume Control) Button
Manual Muting of Audio Alerts
(Radar and SWS™)
Whether Auto-Mute is selected on or off in Selectable
Features, the audio alerts can be completely muted by
pressing the AUD button during an alert. The display will
briefly show “
QQUUIIEETT
” . No audible alert will be heard as
long as the signal is present. The unit will remain in manual
mute mode for approximately 12 seconds from the last
received alert.
Note—because Laser alerts are not lengthy or sustained,
muting is not required (see page 21)
Volume Control
Press and hold the AUD button to engage the
volume control; the volume will cycle high to low.
Release the AUD button when you have reached
your desired audio setting.
CTY (City/Highway) Button
The CTY button has four functions:
1. AutoScan™ Mode
2. Highway Mode
3. City X Filtration Mode
4. City X/K/Ka Filtration Mode
AutoScan™ Mode:
VECTOR 960 and VECTOR 940 are factory shipped
with AutoScan™engaged. Autoscan™is designed to
automatically adjust sensitivity to X and K Band Radar
whatever your driving environment. Whether driving in
densely populated urban areas or “wide open” rural
areas, AutoScan™will automatically reject virtually all
9
k
k
k
k
k

false signals which are shared with traffic Radar on X
and K Bands such as door openers and security
systems. AutoScan™is a “no-fuss” means of achieving
optimum signal selectivity.
Highway:
Select Highway mode when traveling in rural or
highway environments for maximum X, K, Super
Wideband Ka sensitivity.
City X Mode:
Select City X mode when traveling in moderate city
conditions of travel, and some level of X band
filtration is required. Once engaged, weak X band
signals encountered will produce no audible alert
until the signal strength reaches a preset level.
However, visual alerts will be processed the instant
an X band signal is detected, keeping you quietly
informed. Since most “false” X band signals are
weak, the use of the CTY mode allows you to drive
out of their range before they reach the preset level
and trigger a full audio alert.
City All Mode (X, K, Super Wideband Ka):
This mode is ideal for use in areas where a high level
of microwave transmissions can cause falsing on all
three Radar bands. In City All mode, your unit will
provide an initial short alert coupled with visual
confirmation of the band detected and signal
strength in the display. No further audible alert is
provided until the signal strength reaches a preset
level. When no audio alert is provided, the visual
alert keeps you quietly informed.
10
k
k
k

Description of Selectable Features
There are a total of 11 Driver Selectable Features
for VECTOR 960 and 9 Driver Selectable Features
for VECTOR 940. These features may be selected
depending upon your driving environment and preference.
1. AutoMute ON or OFF
2. Radar/Laser Digital Voice or Tone
(Model V960)
2. Radar/Laser/ SWS™ Digital Voice or Tone
(Model V940*)
3. Safety Warning System®ON/OFF
4. Safety Warning System®Digital VOICE or
TONE (Model V960)
5. Audio/Visual Scroll Rate FAST or SLOW
6. Inverted Display Option ON/OFF
7. AutoScan™
(accessed using CTY Button)
8. Normal Mode
(Note: 8-11 accessed using PWR Button)
9. Modifications Mode
10. Q-Start
11.Tech Mode
*Display references Radar and Laser only,
but does include SWS™voice as well.
11

Feature 1 – AutoMute On or Off
With “AAmmuutteeoonn”, your unit will provide several
X, K or Super Wideband Ka audio alerts followed
by the Digital Voice announcement of the signal
detected. After the Digital Voice announcement, a
“clicking” tone keeps you quietly informed for as long
as the signal is present. This clicking becomes more
rapid as the strength of the Radar signal increases.
“AAmmuutteeoonn” enables you to conveniently monitor
extended encounters without having to manually
mute or adjust the volume setting.
With “AAmmuutteeooffff”, your unit will provide a continuous
series of X, K, Super Wideband Ka audio alerts and
Digital Voice announcements of the signal detected.
Digital Voice prompts are provided once after the
initial audio alert. This standard setting is often
preferred when background noise in a vehicle is loud.
Factory setting is “AAmmuutteeooffff”.
Note: because of its urgency, Laser alerts are not affected
by this mode.
Feature 2 – Radar/Laser Digital Voice Prompts
With “VVooiicceeoonn”, unit will provide Digital Voice
prompts followed by “beeps” when X/K/Ka and Laser
signals are detected. With “VVooiicceeooffff”, unit will
sound unique audio tones only. Factory setting is
“VVooiicceeoonn”.
Note: For Model V940, the Digital Voice Feature
of the five SWS™ categories is included with the
Radar/Laser Voice Feature.
Feature 3 – Safety Warning System®(SWS™)
With “SSWWSSoonn”, unit will provide a message when
signals from SWS™transmitters are detected.
Factory setting is “SSWWSSoonn”.
12
k
k
k

Feature 4 – Safety Warning System®Voice or Tone
(Model V960)
When “SSWWSSvvooiiccee” is selected, unit will provide
Digital Voice announcements when SWS™transmitters
are detected. Factory setting is “SSWWSSvvooiiccee”. When
“SSWWSSttoonnee” is selected, Digital Voice is replaced by
tone/clicking only. Factory setting is “SSWWSSvvooiiccee”.
Feature 5 – Audio/Visual Scroll Rate
When “SSCCRRssllooww” is selected, unit will provide a slow
cycling of audio/visual messages. When “SSCCRRffaasstt” is
selected, unit will provide a fast cycling of
audio/visual messages. Factory setting is “SSCCRRssllooww”.
Feature 6– Inverted Display Feature
When selected, your unit can be mounted to the
visor using the hook & loop fastener upside down
and the display will remain right reading. “Upside
down” mounting may allow for easier access to the
unit’s functions.
Note: Inverted display is ON when the check mark symbol
is FLASHING; inverted display is OFF when the underscore
line is flashing.
13
k
k
k

Entering Selectable Features Mode
1. With the unit OFF, press and hold the PWR and CTY
buttons simultaneously. The word “FFEEAATTUURREESS” will
appear in the display, followed by the status of the first
Selectable Feature.
2. Press the AUD button to make your selection.
3. Press the CTY button to move to the next Selectable
Feature. To move backward in the list, press the DRK
button.
4. Press the PWR button to exit Selectable Features mode.
To confirm your unit is ready for operation, and what
mode of travel your unit is operating, the display will
read: “
AAuuttooSSccaann
”, “HHiigghhwwaayy” , “CCiittyyXX” or
CCiittyy AALLLL.
Installation
General Guidelines
Do not mount your unit directly behind windshield
wipers or mirrored sunscreens which block Radar and
Laser signals and substantially reduce warning range.
Unlike “after market” mirrored sun-screens, regular
tinted glass does not affect Radar reception. Radar
signals are also reflected by “heated windshields”
known as Instaclear®and ElectriClear®available as an
option on some vehicles. This type of windshield makes
any dash, visor or windshield mounted detector
ineffective. (If in doubt, check with an appropriate
dealership to see if this applies to your vehicle.)
To achieve optimum performance, regardless of which
mounting position you choose, follow the basic steps
on the following page.
14
k
Instaclear is a registered trademark of the Ford Motor Company.
ElectriClear is a registered Trademark of Libbey, Owens, Ford, and Delco-Remy.

1. Consider occupant safety when selecting a mounting
location. Choose a location where the unit will not be
hazardous in case of an accident.
2. For optimum detection, position your unit with a clear,
unobstructed view of the road from the front and rear.
3. Do not allow the unit to make contact with the
windshield. This will eliminate unnecessary vibration.
4. Avoid placing your unit in direct sunlight. During the
summer, interior temperatures of an enclosed vehicle
can sometimes reach temperatures that will cause
premature aging of the unit.
5. Your detector is not waterproof; exposure to water may
cause damage and your warranty will be void.
Dash Mounting
You can mount your unit to a level area of your
vehicle’s dash using the hook and loop fastener or the
four, non-skid dash mounting pads provided.
Windshield Mounting
1. Remove the mounting cover on the top of the
detector by pressing on the raised dots and pushing
outward.
2. Insert the “grooved” cover plate supplied until it locks
into place.
3. Clean the desired area of the windshield, and adhere
the windshield/visor bracket by pressing on the suction
cups.
4. Slide the detector onto the mounting bracket until it
“locks” into place.
15
k
k

5. To adjust the angle of the
bracket, squeeze and hold the
circular “buttons” on the sides
of the bracket; this will allow
you to angle the bracket to
your windshield.
Note—some vehicles have a
plastic coating on the inside
of the windshield designed to
protect occupants in case of
an accident. Use of the
windshield bracket on this type of windshield can
permanently mark the surface. Check with your dealer if you
are unsure whether your vehicle is equipped with this type of
windshield.
Visor Mounting
1. Remove the two suction cups and follow steps
1, 2, 4 and 5.
2. Clip the detector to the edge of the sun visor nearest
the windshield.
Fuse Replacement
If the fuse has blown, remove the tip from the lighter
plug followed by the old fuse. Replace the fuse with a
1-amp, 3AG fuse. Defeating the fuse protection can
damage your unit or your vehicle’s electrical system
and will void your warranty.
Note—the tip is in two pieces; be careful not to lose either
piece or the spring inside the holder. (See diagram below).
16
k
k

Understanding Radar, Laser and SWS™
Three Radar Frequencies
Three microwave frequencies have been allocated by
the FCC (Federal Communications Commission) and
are used for traffic Radar. They are:
•X Band: 10.525 GHz
•K Band: 24.150GHz
•Super Wideband Ka: 33.4 GHz to 36.0 GHz
Both X and K bands are well known to motorists who
have traveled with Radar detectors. Introduced first
was X band Radar which became common during the
1960s. In the mid 1970s the lower powered, more
difficult to detect K band Radar was introduced.
In 1987, FCC approval was given for Radar equipment
using a third frequency, Ka. In response to this,
BELTRONICS introduced the first Radar detectors
capable of detecting X, K and Ka Band signals.
In late 1990, FCC approval was given to Wideband
Ka: 34.2 GHz to 35.2 GHz. Once again, BEL
responded with Wideband Ka detection.
Today, BEL’s VECTOR SERIESdetects the complete
Super Wideband Ka frequency allotted for police
monitoring–33.4 GHz to 36.0 GHz.
Total Tracking Laser™ (TTL™)
Unlike Radar signals, which are highly reflective,
Laser signals have very poor reflective characteristics.
Many of today’s Laser detectors do not have the high
sensitivity necessary to detect Laser within a large
“field of view”. Your unit incorporates BEL’s number one
rated Laser detection. Twin Laser ports detect energy
far outside the main Laser beam—including
off-axis signals—providing the largest achievable 360°
“field of view.” The alerts provided by your unit are
the same whether signals are received from the front
or rear.
17
k
k

Safety Warning System®(SWS™)—What is it?
The Radio Association Defending Airwave Rights, Inc.
(R.A.D.A.R.) conceived and developed the Safety
Warning System®.The concept behind this system is
to warn motorists of potential road hazards by
employing Safety Warning System®transmitters in
areas such as construction zones, accident sites and
detours. These SWS™transmitters operate within
the 24 GHz portion of the K band frequency, and
broadcast uniquely coded signals that are detected
by your unit. I
Interpretation of Alerts
Radar Alerts
The alerts provided by your unit are affected both by
the type of transmission (continuous wave or instant-
on), and the position of the Radar source. Generally,
when you drive closer to a Radar source, the intensity
of the received signal increases, resulting in the
increase of the number of bar graph segments as
well as numerical digit 11--99(Model V960 only) and a
corresponding increase in the audio alert rate.
Described below are five common types of Radar
encounters and the alerts you will typically receive.
1. Stationary or moving Radar,
straight ahead or aimed in your direction
Since Radar signals travel in a straight line, this
Radar encounter potentially offers maximum warning
range. Once the signal is received, the initial warning
consists of an X, K or Super Wideband Ka audio
18
k
k

alert coupled with simultaneous identification of the
Radar band (X, K or Ka) and signal strength in the
Text Display. The number of bar graph segments
displayed depends upon the strength of the signal
received. As the strength of the Radar signal
increases, the audio alert becomes more rapid and
the bar graph will display the maximum number of
five segments indicating maximum signal strength.
Assuming the Radar signal remains uninterrupted,
the audible and visual alerts will clearly indicate a
“weak” signal becoming stronger as you drive closer
to the Radar source. Remember, when the police
Radar source is moving toward you, the Radar signal
strength will increase much more rapidly than if you
are approaching a stationary source.
2. Stationary Radar aimed around a corner
Under this circumstance, reaction time is considerably
reduced. Since the Radar signals are transmitted
across your line of travel, there is generally no signal
available to receive until you are relatively close to the
source. Once an alert is received, expect the strength
of the signal to increase very quickly. Advanced
warning in this situation may be reduced.
19