Montigo MD34-DV-2 User manual

nCheck local codes and
read all instructions
prior to installation.
nLeavethismanualwith
the owner.
Modular
Gas Fireplace
MD34-DV-2
Homefire
Installation
Operation &
Maintenance
What To Do If You Smell Gas:
 Do not try to light any appliance.
 Do not touch any electrical switch; do not use any phone in your building.
 Immediately call your gas supplier from a neighbor's phone. Follow the gas
supplier's instructions.
 If you cannot reach your gas supplier, call the fire department.
Warning:
Improper installation, adjustment,
alteration, service or maintenance can cause
injury or property damage. efer to this
manual. For assistance or additional
information consult a qualified installer,
service agency or the gas supplier.
For Your Safety:
Do not store or use gasoline
or other flammable vapors
and liquids in the vicinity of
this or any other appliance.
Questions? Email us at [email protected] or visit our website at www.montigo.com.

Page 2 Part No. XG0106B
MD34-DV-2 Homefire
Introduction
About Modular Fireplaces and the Homefire Plus:
The MD34-DV-2 Homefire Plus includes a 25,000 BTU dual burner
and embers. All 4 Series Modular Fireplaces allow quick and
easy upgrades in the future. The MD 4-DV-2 can be upgraded to a
Wildfire Burner. Contact your dealer for more information. The
MD 4-DV-2 model is available in four versions:
nTop Vent (Product Code MD 4DT-2)
nRear Vent (Product Code MD 4DR-2)
nElectronic Ignition - Top Vent (Product Code MD 4DT-I-2)
nElectronic Ignition - Rear Vent (Product Code MD 4DR-I-2)
The MD 4-DV-2 is certified as a VentedGas FireplaceHeater (ANSI
Z21.88-2000 · CSA 2. -2000) and is rated for:
NaturalGas 24,500 BTU/H (7.2 Kilowatts) Maximum Input
19,500 BTU/H (5.7 Kilowatts) Minimum Input
Propane 2 ,000 BTU/H (6.7 Kilowatts) Maximum Input
17,700 BTU/H (5.2 Kilowatts) Minimum Input
How to use this manual:
This manual covers all models and unless otherwise specified, the
designation MD 4-DV-2 refers to all models. Sections which are specific
to a particular model are marked with a symbol, plus the
appropriate model number.
Warranty and Installation Information:
The Montigo warranty will be voided by, and Montigo disclaims any
responsibility for, the following actions:
nModification of the fireplace and/or components including Direct-Vent
assembly or glass doors.
nUse of any component part not manufactured or approved by
Montigo in combination with this Montigo fireplace system.
nInstallation other than as instructed in this manual.
Consult your local Gas Inspection Branch on installation require-
ments for factory-built gas fireplaces. Installation & repairs should
be done by a qualified contractor.
Installations in Canada must conform to the current CAN/CGA
B-149.1 and .2 Gas Installation Code and local regulations. If the
optional air-circulating fan kit is installed, it must be electrically
grounded in accordance with CSA C22.1 Canadian Electrical Code
Part 1 and/or Local Codes.
Installations in the USA must conform to local codes, or in the
absense of local codes to the National Fuel Gas Code, ANSI
Z223.1-1988. If the optional air-circulating fan is installed, it must
be grounded in accordance with local codes or, in the absence of
local codes, with the National Electrical Code, ANSI/NFPA 70-
1987.
Table Of Contents
Introduction............................................................................2
Installation
Installing the Fireplace Shell ........................................
Installing the Gasline .................................................... 4
The Remote Switch ......................................................4
Direct Vent Installation .................................................. 4
General Requirements ....................................4
Terminations.................................................... 5
Top Vent Through-the-Wall Installations ......... 6
Top Vent Through-the-Roof Installations ........ 8
Rear Vent Through-the-Wall Installations ....... 9
Rear Vent Multi-Elbow Installations ...............10
Construction around the fireplace
Facing ............................................................11
Mantels and Surrounds ................................. 11
Wiring ............................................................... 11 - 12
Installing the Logset ....................................................12
Removing and Installing the Insert ............................1
Removing and Installing the Door ............................. 1
Operation...................................................................... 14 - 16
Maintenance................................................................. 16 - 17
Warranty................................................................................18
Appendix
A. Termination Locations ...........................................19
CAUTIONS
Due to its high operating temperatures, the appliance
should be located out of traffic & away from furniture and
draperies.
nChildren and adults should be alerted to the hazards
of the high surface temperature, which could cause
burns or clothing ignition.
nYoung children should be carefully supervised when
they are in the same room as the appliance.
nClothing or other flammable materials should not be
placed on or near the appliance.

Page 3
Part No. XG0106B
MD34-DV-2 Homefire
Installing The Fireplace Shell
The fireplace may be installed in any location that maintains proper
clearances to air conditioning ducts, electrical wiring and plumbing.
Safety, as well as efficiency of operation, must be considered when
selecting the fireplace location. Try to select a location that does not
interfere with room traffic, has adequate ventilation, and offers an
accessible pathway for Direct Vent installation. Refer to page 4 - Vent
Installationfor more information.
The fireplace dimensions are shown below:
Installation
When installing a shelf over the top of the fireplace, the following
guidelines must be adhered to: For Rear Vent models (MD34DR-2),
the minimum clearance from the top of the fireplace to a shelf is 7". For
Top Vent models (MD34DT-2), the minimum clearance when using the
CRS 0 is 15". (Minimum1"clearancemuststillbemaintainedaround
theventpipes.)
Figure 4. Framing for shelves over the fireplace.
Figure 3. Corner framing dimensions.
Figure 2. Framing dimensions.
* When sheetrock is
not used behind the
fireplace, framing
depth may be
reduced to 15"
Framing
WARNING:
When this appliance is installed directly on carpeting, tile or any
combustible material other than wood flooring, it must be
installed on a metal or wood panel extending the full width and
depth of the appliance.
Rear Vent
Clearances
The MD34-DV-2clearances to combustible materials are:
Top-RearVent* 7"
Top-TopVent*** 35"
Back 0"
Side 1"
Floor 0"
Mantle** 10"
* Clearance from the top of the fireplace to a combustible
ceiling within the fireplace enclosure.
** Refer to page 11.
*** If the standard elbow (MEL90) is used with the Low
Clearance Sleeve (CRS 0) the Top Clearance is 15".
If the Low Clearance Sleeve (CRS 0) is NOT used
over the elbow, the Top Clearance is 5".
Top Vent
Front View
Figure 1. Fireplace dimensions.
15
26 1/8
32
Ø7
Ø4
34
C
15
31 1/2
Ø7Ø4
8 3/4
33
15 3/4
36
22 1/4
0" clearance
to corners only
4233
59 3/8
Rear Vent Top Vent
Unprotected combustible walls which are perpendicular to the
fireplace opening, must not project beyond the shaded area shown
in Figure 19b.
For protection against freezing temperatures, it is recommended
that outer walls of the chase be insulated with a vapour barrier. This
will reduce the possibility of a cold-air convection current on the
fireplace.

Page 4 Part No. XG0106B
MD34-DV-2 Homefire
Vent Installation
This section covers the installation of direct venting and terminations.
InstallationRequirements
nMD 4-DV-2 fireplaces are certified for use with Montigo Standard
Series (4" / 7") venting components
nMinimum 1" clearance to combustibles required for vent pipes
nUse only certified Montigo vent components. (Use of other
parts will void the Montigo warranty, and may impede the
operation of the fireplace.)
nAll joints must be secured with a minimum of two screws per joint
nVent terminations must not be recessed in walls or siding
nHorizontal runs must be supported by a minimum of two supports
per horizontal run. A minimusm of one screw on each side of
support is also required
nFlex vent sections may be stretched up to 50% of their total length
(eg. a 24" section may be stretched to 6")
nMaximum horizontal run for a flex section with no vertical rise is feet.
nFlex vent sections over feet must fall within the limits set by the
venting graph and must have a minimum vertical rise of inches
per foot of flex.
nSolid vent sections may be cut less than half way from the tapered end
nVenting components can be used in any combination of solid/rigid
pipe or flex pipe and in any orientation (Male connectors can face
in any direction)
Vent Terminations
Selecting A Termination Location
Choosing your vent termination location will help to determine whether
you need to use a top vent or rear vent fireplace. Figure 6, below,
shows typical fireplace locations and the venting options they provide.
For a more detailed diagram of allowed termination locations, see
Appendix B.
Cautions:Cautions:
Cautions:Cautions:
Cautions:
Installing The Gas Line
The gas line must be installed before finishing the MD 4-DV-2 Fireplace.
NaturalGas requires a minimum inlet gas supply pressure of 5.5"
W.C. & a manifold pressure of .5" W.C. PropaneGas requires a
minimum inlet gas supply pressure of 11" W.C. & a manifold pressure of
10" W.C. Provision must also be made for a 1/8" N.P.T. plugged tapping
and be accessible for test gauge connection immediately upstream of the
gas supply controls to the appliance. The fireplace gas connection and
the main operating gas valve is located behind the removable brass trim
at the bottom of the unit and need only be attached to the gas line with an
approved fitting, as required by the applicableinstallation codes.
Installation
Figure 6. Fireplace locations and vent terminations.
Note: After gas line is connected, eachappliance connection,
valve and valve train must be checked while under
normal operating pressure with either a liquid solution, or
leak detection device, to locate any source of leak. Tighten
any areas where bubbling appears or leak is detected until
bubbling stops completely or leak is no longer detected.
DO NOT use a flame of any kind to test for leaks.
Installing The Remote Switch
The MD34-DV-2's gas valve, located behind the lower brass trim, may
be connected to a wall switch. The valve generates its own power. This
is a millivolt circuit. Use only low voltage wire, and DONOT connect any
external power to it.
Refer to Figure 28 for wiring requirements.
Note: The switch location must not exceed 0' from the fireplace.
Figure 5. Gas line access.
During any pressure testing of the gas supply piping that excedes 1/2
psig ( .5 kPa), the appliance and its individual shutoff valve must be
disconnectedfrom gas supply system.
When pressure testing the gas supply piping system at test pressures of
lessthanorequalto1/2 psig ( .5 kPa), the appliance must be isolated
from the gas supply piping system by closing its individual manual shutoff
valve.
nVent terminations can be very hot. If the termination is less
than 7 feet above a public walkway, it should be fitted with a
certified Montigo Heat Guard. (Part no. MTKOG)
nDo not obstruct, or attempt to conceal, the vent termination.
These actions will affect the operation of the fireplace, and
may be hazardous.
nIn heavy snow areas, take extra care to prevent snow buildup
from obstructing the vent termination.

Page 5
Part No. XG0106B
MD34-DV-2 Homefire
Installation
Installing Terminations with Built-In Frames
Installing Terminations with MSR Frames
12
12
1. Frame the termination opening to 12" x 12".
2. Fasten the termination to the studs using a minimum of 4
screws.
11
11
1. Frame the termination opening to 11" x 11".
2. Fasten the termination to the studs using a minimum of 4
screws.
Installing Terminations with MOSR Frames
1212
12
MOSR
1. Frame the termination opening to 12" x 12".
2. Fasten the MOSR frame to the interior side of the studs using
a minimum of 4 screws.
. Insert the termination into the MOSR frame as shown here,
and attach by screwing through the four pilot holes in the
termination.
MSR
MTO-3
MTO-3F
MTO-3
MTKOG
1. Ensure that the two long mounting brackets are facing the
bottom of the termination. (See inset). This will provide more
heat protection at the top of the termination, where tempera-
tures are highest.
2. Attach to the faceplate of the termination using four sheet metal
screws.
Installing Heat Guards over Terminations

Page 6 Part No. XG0106B
MD34-DV-2 Homefire
Installation
Top Vent Venting Runs
For the MD 4-DV-2, there are two types of installations: A) Through-
The-Wall Installations and B) Vertical (Through-The-Roof) Installations.
A)Through-The-WallInstallations
Before you install any venting, you must determine whether the venting
run will be acceptable. Unacceptable venting can affect the fireplace's
combustion.
TheVenting Graph
Measure the vertical height from the fireplace hearth to the centre of the
termination and the horizontal run from the from the fireplace flue collar to
the wall flange of the termination. Plot on the Venting Graph (Fig. 7) with
an 'X'.
If the 'X' falls on or above the top boundary of the shaded area, the
installation is acceptable.
Example A: (Acceptable Installation)
If the vertical dimension from the hearth is 84" and
the horizontal run to the wall flange of the vent
termination is 36", this would be an acceptable
installation.
Example B: (Acceptable Installation)
If the vertical dimension from the hearth is 90" and
the horizontal run to the wall flange of the vent
termination is 126", this would be an acceptable
installation.
Example C: (Unacceptable Installation)
If the vertical dimension from the floor of the fire-
place is 78" and the horizontal run to the wall flange
of the vent termination is 108", this would NOT be
an acceptable installation.
012 24 36 48 60 72 84 96 108 132120 144 156 168 180
Horizontal Run (in.)
Hearth
0
12
24
36
48
60
72
84
96
108
Figure 8. Heat Shield. Install by sliding over the vent pipe where it
passes through combustible construction.
Heat Shields
Due to high flue temperatures, heat shields
are required on all 4 Series Modular
Direct Vent installations (except those with
vertical terminations) at the point where the
venting connects to the termination. With
the heat shield, vent clearances can be
maintained at 1".
Figure 7. MD 4-DV-2 Top Vent Venting Graph
Top Vent
Available Top Vent Components
The following venting components are available for the MD34-DV-2
Top Vent:
A - Termination MTO-3 (3" length)
MTO-3F (3" length)
B - Stucco Kits MSR (stucco frame)
MOSR (stucco can)
BSR (brick can)
D - Flex sections MFL-1 (12" section)
MFL-18 (18" section)
MFL-2 (24" section)
MFL-3 (36" section)
MFL-4 (48" section)
E - Solid sections EXT-18 (18" f/f section)
MEXT-1 (12" m/f section)
MEXT-2 (24" m/f section)
MEXT-3 (36" m/f section)
MEXT-4 (48" m/f section)
F - Elbows MEL-90M (m/m 90° elbow)
MEL-90F (f/f 90° elbow)
MEL-90FM (f/m 90° elbow)
EEL-45 (f/m 45° elbow)
NOTES: All dimension lengths for vertical or horizontal runs
are measured from center of the vent pipe.
Venting runs must fall within the limits set by the
venting graph (see Figure 7).

Page 7
Part No. XG0106B
MD34-DV-2 Homefire
Installation
Figure 10. Extended Installation using a combination of solid and
flex venting. Use the vent graph to determine your
allowable run, then select appropriate components.
Figure 11. Retracted Installation using a combination of solid and
flex venting. Use the vent graph to determine your
allowable run, then select appropriate components.
Figure12. Horizontal flex installation with no vertical rise.
Hearth
Termination
Exterior
Wall
3' max.
Flex Section
Hearth
Flex Section Termination
Exterior
Wall
126"
30" Max.
Solid Section w/
90°Elbow
Heat
Shield
Heat
Shield
Top Vent
Hearth
Flex Section
Solid Sections Termination
Exterior
Wall
Heat
Shield
150" max.
30" max.
Example1:
For our shortest venting configuration use components A and F
(see Figure 9a).
Figure 9a. Typical Top Vent installation. If the 90° elbow is installed
directly on the fireplace, the height to the center of the
termination is 44".
Horizontal Venting
Figure 9b. Typical Top Vent installation. The solid sections can be
used in various combinations to obtain the desired vent
run. The vent run must fall within the limits set by the
venting graph.
90°Elbow
MEXT Section
Heat Shield
Heat Shield
MEL-90F/F Elbow
Termination
Example 2:
A 10' section and elbow (MIHR-10) used in conjunction with ft. flex
section (MFL- ) will, when extended in a five foot chase, allow for a
maximum horizontal run of twelve and one-half feet from the centre
of the fireplace to outside wall and a minimum of 8' when retracted
in opposite direction (see Figure 10 and 11).
"D" flex sections and "E" solid sections may be used in conjunction
with one another to obtain different possible horizontal length
installations. NOTE:Flex sections with no vertical rise must not exceed
maximum horizontal length of feet (seeFigure12). Flex runs over
feet must fall within the limits set by the venting graph, and must have a
minimum vertical rise of " per foot of flex.
Termination

Page 8 Part No. XG0106B
MD34-DV-2 Homefire
2' min.
Storm collar
Support ring
Roof flashing
30' max.
* Minimum 1" clearance to all combustibles
Support plate
Firestop
Installation
B. Vertical (Through-The-Roof) Installations
nVertical Terminations must be installed:
•minimum 2' (two feet) above the highest point where
vent passes through the roof.
•minimum 6' (six feet) from a mechanical air inlet
•minimum 18" (1 1/2" feet) from a parapet wall.
nMaximum vent height is 0 feet above fireplace.
Note: Flame characteristics will change if the maximum vent
height is used.
nMinimum clearances 1" from vent to all combustible materials
must be maintained.
Figure 13. Straight, vertical venting using required MXT-10 adaptor.
nA maximum of two offsets (eachoffsethastwo90°bends) may be
made and shall not exceed total length of 25% of the vertical vent height,
when measured center to center of piping.
Example: Typical vent installation.
20' vertical vent
2 - 2' offsets required
25% of 20' = 5' max. offset allowed
This venting configuration meets requirements.
A - Termination MVTK-1
B - Flex sections MFL-1 (12" section)
MFL-2 (24" section)
MFL-3 (36" section)
MFL-4 (48" section)
C - Solid sections MEXT-1 (12" section)
MEXT-2 (24" section)
MEXT-3 (36" section)
MEXT-4 (48" section)
D - Support Ring & Plate MSPXT-8(7"dia.)
E - Firestop FS-7 (7" dia.)
F - Roof Flashing MRF-7 (1/12 - 7/12 pitch)
MRF-12 (7/12 - 12/12 pt.)
MRF-16 (12/12 - 16/12 pt.)
Figure14b. Vertical venting with 2 offsets (1 offset= two 90° bends).
Figure14a. Vertical venting with 1 offset (1 offset= two 90° bends).
2' min.
2'
Storm collar
Roof flashing
30' max.
* Minimum 1" clearance to all combustibles
Support straps or
support plate & ring
Firestop
Firestop
Firestop
Support plate
& ring
30'max.
30'max.
Top Vent
Storm collar
Support ring
MEXT
Solid Section
Roof flashing
30' max.
* Minimum 1" clearance to all combustibles
Support plate
Firestop
Firestop
2' min.
MXT-10
Adaptor
MEXT
Flue
Collar
30'max.

Page 9
Part No. XG0106B
MD34-DV-2 Homefire
Installation Rear Vent
2. 45° Corner Installation.
Attach an EEL-45 (45° elbow) directly onto the flue collar. Cut
the EXT-18 to suit, and attach it to the EEL-45. Slide the
fireplace into position and attach to the termination.
Rear Vent Venting Runs
The MD34-DV-2RearVenthas three possible installations which do
not require vertical lift:
Heat Shields
Due to high flue temperatures, heat shields are required on all MD 4-
DV-2 installations (except those with vertical terminations) at the point
where the venting connects to the termination. With the heat shield, vent
clearances can be maintained at 1".
See Figure 8.
1. Straight Installation.
The height from the hearth to the center of the termination is 26
1/8". MD 4-DV-2 Rear Vent versions are supplied with an 18"
extension pipe (EXT-18) with female/female connections. For
shorter installations, cut the EXT-18 to the desired length.
For extended installations, use the EXT-18 section as supplied
for an 18" vent run.
Note: For Rear Vent models, maximum horizontal run with
no vertical lift must never exceed 18".
Flue Collar
Heat Shield
EXT-18
Termination
Figure 15. Extended installation.
Heat Shield
EXT-18
Termination
EEL-45
Elbow
Flue Collar
Figure 16. Corner installation.
3. Corner Installation - 45° or less.
Use an MTO- termination and an MFL-1 or MFL-18 (12" or
18" compressed length) and a frame, if appropriate. Flex may
be turned to obtain desired degree of angle required but must
not exceed 45°.
Figure 17. Flex installation.
Heat Shield
Termination
Flex
Section
Flue Collar

Page 10 Part No. XG0106B
MD34-DV-2 Homefire
Installation Rear Vent
B. Multi-Elbow Installations
For more diffiicult installation situations, the MD 4-DV-2 Rear Vent may
be installed with 2 - 90° elbows and up to 15' of horizontal run. If using
this installation option, you must adhere to the following guidelines:
nthe first 90° elbow must be placed directly on the flue collar
nyou must have a minimum vertical lift of 50" (measured from the
hearth)
nyour vent run must fall within the limits set by Figure 19
Before you install any venting, you must determine whether the venting
run will be acceptable. Unacceptable venting can affect the fireplace's
combustion.
The Venting Graph
Measure the vertical height from the fireplace hearth to the centre of the
termination and the horizontal run from the from the fireplace flue collar to
the wall flange of the termination. Plot on the Venting Graph (Fig. 19)
with an 'X'.
If the 'X' falls on or above the top boundary of the shaded area, the
installation is acceptable.
Example A: (Acceptable Installation)
If the vertical dimension from the hearth is 84" and
the horizontal run to the wall flange of the vent
termination is 36", this would be an acceptable
installation.
Example B: (Acceptable Installation)
If the vertical dimension from the hearth is 90" and
the horizontal run to the wall flange of the vent
termination is 126", this would be an acceptable
installation.
Example C: (Unacceptable Installation)
If the vertical dimension from the floor of the fire-
place is 78" and the horizontal run to the wall flange
of the vent termination is 108", this would NOT be
an acceptable installation.
Figure 19. MD 4-DV-2 Rear Vent Venting Graph
012 24 36 48 60 72 84 96 108 132120 144 156 168 180
Horizontal Run (in.)
Hearth
0
12
24
36
48
60
72
84
96
108
Installation Of Rear Vent DV
MD 4-DV-2 Rear Vent versions are supplied with an EXT-18 (female/
female) section. In addition, the following venting components are
available for Rear Vent installations:
A-Termination MTO-3(3"length)
MTO-3F(3"length)
B - Stucco Kits MSR (stucco frame)
BSR-4 (4" brick frame)
BSR-6 (6" brick frame)
MOSR (stucco can)
D - Flex sections MFL-1(12"section)
MFL-18 (18" section)
MFL-2 (24" section)
MFL-3 (36" section)
MFL-4 (48" section)
E - Solid sections MEXT-1 (12" section)
MEXT-2 (24" section)
MEXT-3 (36" section)
MEXT-4(48"section)
F-90degree elbow
MEL-90M (m/m 90° elbow)
MEL-90F (f/f 90° elbow)
MEL-90FM(f/m90°elbow)
EEL-45 (f/m 45° elbow)
Figure 20. Multi-elbow installation. Distance 'H' must be a minumum
of 50". The vent run must comply with figure 19.
NOTES: All dimension lengths for vertical or horizontal runs
are measured from center of the vent pipe.
Venting runs must fall within the limits set by the
venting graph (see Figure 19).
8"
H
L
min 8"
max 18"

Page 11
Part No. XG0106B
MD34-DV-2 Homefire
Finishing Around the Fireplace
Combustible mantels and mouldings may be safely installed over
the top and on the front of the fireplace provided that they do not
project beyond shaded area shown in Figure 21a. Side wall
clearances are ". Combustible surrounds may be installed with "
clearance to the side of the fireplace as shown in Figure 21b.
Fireplace Facing
When selecting the finish material for your fireplace, it is important to
remember the following: BRASS TRIMS MUST NOT BE OB-
STRUCTED IN ANY WAY - to do so restricts the air supply for
the control compartments and heat exchanger it also pre-
vents access for servicing controls.
The face of the fireplace may be painted to match the room decor,
provided you use a heat-resistant paint. Decorative facing must not
extend past the fireplace opening at all, because it will interfere with
the access to retainers for removal of glass door.
Installation
We recommend careful consideration be given to the effects of
elevated mantel temperatures which may be in excess of product
design, for example: candles, plastic or pictures. This can cause
melting, deformation, discoloration or premature failure of T.V. and
radio components.
Sheetrock/
Drywall
Header
3
45°
Painting:
Special care is recommended by the Master Painters and Decora-
tors Association, when painting the fireplace surrounds, to select
and apply a quality Alkyd sealer prior to the applying of latex
paints. This is to prevent leaching of water from evaporation and
causing a brownish staining effect to paint over coats.
Top of fireplace
Combustible Facing
Combustible construction
allowed in shaded area.
123456789101112
Figure 21a. Combustible mantles and facings.
Mantels & Surrounds
NOTE: National Canadian Gas Association mantel test require-
ments are for fire hazard prevention to combustible materials.
New technology, to meet consumer and government demands for
the wise use of energy, has prompted us to manufacture many
models of fireplaces which are hot, fuel and energy efficient.
Please be aware; temperatures over the mantel will rise above
normal room temperature and walls above fireplace may be hot to
touch.
Figure 21b. Combustible surrounds and facings.
Wiring
Gas Control and Pilot Wiring MD34-DV-I-2
Figure 22. Wiring for the MD 4-DV-I-2 with Honeywell gas control
and pilot.
Honeywell (Q3450)
Pilot Assembly
Pilot Electrical
Harness Connector
Honeywell Gas
Control (SV9501M)
Gas Control
Connector Fuse
Limit
Switch Wall
Switch
Fan Plug
Receptacle
Junction Box
Junction Box Cover
White
Black
Green
40 VA
Transformer
115VAC
24VAC
Grnd Screw
combustiblefacing

Page 12 Part No. XG0106B
MD34-DV-2 Homefire
Installation
Figure 23a. Wiring for optional air circulating fan kit.
Wiring for the optional Fan Kit
All 4 Series Modular fireplaces feature an optional fan kit for
circulating heat into the living space.
Installations in Canada which employ the fans must be electri-
cally grounded in accordance with CSA C22.1 Canadian Electrical
Code Part 1 and/or Local Codes.
Installations in the USA which employ the fans must be
grounded in accordance with local codes or, in the absence of local
codes, with the National Electrical Code, ANSI/NFPA 70-1987.
For more information see the Fan Kit Installation Guide included
with the fan kit.
NOTE: If any of the original wire supplied with the appliance is replaced, it
must be replaced with the same type, or its equivalent.
G
L1-WH
L2-BLK
Quick Connect
plug to motor
Figure 23b. Wiring schematic for optional fan kit.
115/1/60 Supply
G L1 L2
Installing the Log Set
Installing the Logs:
The MD34-DV-2is supplied with six ceramic fibre logs. Unpack the logs
and handle them very carefully.
1. Remove the door cover and the glass door.
2. Place the Back log onto the back log rest as shown below in
figure 24a. The log has lip on the bottom which fits into the
slot on the log rest.
3. Place the Front log onto the front log rest as shown in figure
24a. Center the log from side to side, and push it against the
back of the log rest. Carefully push the log onto the metal
spikes on the log rest.
4. Place the top logs in position as shown in figures 24b and
24c.
5. Start the fireplace. If the flame appears satisfactory, replace
the glass door and door cover.
Figure 24a. Positioning for the front and back logs.
Back log
Left log Right log
Front log
Center logs
Figure 24b. Proper top log placement (top view).
Back log
Left log Right log
Front log
Center logs
Figure 24c. Log placement as seen from the front of the stove.
Back log
Front log rest
Back log rest
Front log
Front burner tube
Back burner tube Ember tray

Page 13
Part No. XG0106B
MD34-DV-2 Homefire
Installation
Removing and Installing
the Insert
You may remove the insert to protect it from theft and damage
during construction.
1. Remove the two machine screws (1 left & 1 right) at the top of
the insert that attach the insert to the shell. See Inset 1.
2. Remove the fresh air flex from the collars on the shell. See
Figure 25. Important: Be careful not to damage the fresh
air flex during removal or storage.
3. Remove the 4 machine screws that hold the venting plate to
the insert.
4. Remove the insert by tipping the top of the insert outward and
lifting the tabs past the slots in the bottom of the shell. See
Inset 2.
Store the screws and clamps in a safe place to ensure that they are
not lost.
To re-install the insert simply reverse the steps above.
Figure 25. MD 4-DV-2 insert.
INSET 1
Tab
INSET 2
Mounting
Bracket
Fresh Air
Flex (4" dia.)
High temp.
silicone seal
Venting Plate
Front
Slot
Removing and Installing
the Door
Removingthe Door:
Remove the trim (as described on the next page) to access the door
latches. Open the latches by pulling Part A upwards and towards you to
disengage Part B from the door. Lift Part B clear of the door. Repeat for
all three latches. Be sure to hold the door carefully so it does not fall.
(Seefigure 26a.)
Once the three latches are unhinged, tilt the top of the door forward and
lift it out of the slots.Seefigure26b.
Figure26a. Operating the door latches.
Figure 26b. Removing the door.

Page 14 Part No. XG0106B
MD34-DV-2 Homefire
WARNING: If you do not follow these instructions exactly, a fire or explosion
may result causing property damage, personal injury or loss of life.
nIf you cannot reach your gas supplier, call the Fire
Department.
C. Use only your hand to push in or turn the gas control knob.
Never use tools. If the knob will not push in or turn by
hand, don't try to repair it, call a qualified service technician.
Force or attempt to repair may result in a fire or explosion.
D. Do not use this appliance if any part has been under water.
Immediately call a qualified service technician to inspect the
appliance and to replace any part of the control system, and
any gas control which has been under water.
A. This appliance has a pilot which must be lighted by hand.
When lighting the pilot, follow these instructions exactly.
B. BEFORE LIGHTING smell all around the appliance area for
gas. Be sure to smell next to the floor because some gas is
heavier than air and will settle on the floor.
What To Do If You Smell Gas:
nDo not try to light any appliance.
nDo not touch any electrical switch; do not use any
phone in your building.
nImmediately call your gas supplier from a neighbour's
phone. Follow the gas supplier's instructions.
To Turn Off Gas To Appliance:
Operation - Model MD34-DV-2
. Push in gas control knob slightly and turn clockwise
to "Off". Do not force.
4. Flip up lower trim.
1. Turn off remote switch.
2. Flip down lower trim.
1. STOP! Read the safety information above on this label.
2. Flip down lower trims.
3. Push in gas control knob and turn clockwise to
"OFF."
4. Wait five (5) minutes to clear out any gas. Smell for gas,
including near the floor. If you then smell gas, STOP!
Follow "B" in the safety information above on this label. If
you don't smell gas, go to the next step.
5. Locate pilot burner (See illustration at right.) and follow
steps below.
6. Turn knob on gas control counterclockwise to
"PILOT."
7. Push in gas control knob completely and hold. Light with
Piezo Igniter button. Continue to hold the control knob in for
about (1) minute after the pilot is lit. Release the knob and it
will pop back up. Pilot should remain lit. If it goes out repeat
steps through 8.
nIf knob does not pop up when released. Stop and
immediately call your service
technician or gas supplier.
nIf the pilot will not stay lit after
several tries, turn the gas control
knob to "OFF" and call your service
technician or gas supplier.
8. Push in gas control knob and turn counterclockwise
to "ON."
9. Flip up lower trim.
10.Turn on remote switch to ignite fire.
Lighting Instructions:
MD34-DV-2
with Continuous Pilot
For Your Safety - READ BEFORE LIGHTING:
NOTE: Knob cannot be turned from
"PILOT" to "OFF" unless knob is
pushed in slightly. Do not force.
Gas Control Knob
(Shown in "Pilot" postion.)

Page 15
Part No. XG0106B
MD34-DV-2 Homefire
For Your Safety - READ BEFORE LIGHTING:
To Turn Off Gas To Appliance:
Lighting Instructions:
nIf you cannot reach your gas supplier, call the Fire
Department.
C. Use only your hand to push in or turn the gas control knob.
Never use tools. If the knob will not push in or turn by
hand, don't try to repair it, call a qualified service
technician. Force or attempt to repair may result in a fire or
explosion.
D. Do not use this appliance if any part has been under water.
Immediately call a qualified service technician to inspect
the appliance and to replace any part of the control system,
and any gas control which has been under water.
A. This appliance is equipped with an ignition system that
lights the pilot burner automatically. Do not attempt to
light the pilot by hand.
B. BEFORE LIGHTING smell all around the appliance area
for gas. Be sure to smell next to the floor because some
gas is heavier than air and will settle on the floor.
What To Do If You Smell Gas:
nDo not try to light any appliance.
nDo not touch any electrical switch; do not use any
phone in your building.
nImmediately call your gas supplier from a neighbour's
phone. Follow the gas supplier's instructions.
1. Turn off remote switch.
2. Flip down lower trim.
3. Turn the switch on the gas control to "Off".
4. Flip up trim.
1. STOP! Read the safety information above on this label.
2. Flip down lower trims.
3. Turn switch on the gas control to OFF".
4. Wait 5 minutes to clear out any gas. If you smell gas,
STOP! Follow "B" in the safety information above on this
label. If you don't smell gas, go to the next step.
5. Turn switch on the gas control to "ON". NOTE: This unit is
equipped with an ignition system that lights the pilot burner
automatically. Do not attempt to light the pilot by hand.
6. Turn on wall switch.
7. Flip up lower trim.
8. If the fireplace does not operate, follow the instructions "To
Turn Off Gas To Appliance" and call your service
technician or gas supplier.
with Honeywell Intermittent Pilot
WARNING: If you do not follow these instructions exactly, a fire or explosion
may result causing property damage, personal injury or loss of life.
Operation - Model MD34-DV-I-2
MD34-DV-I-2
Gas
Inlet
Gas Control Switch
Shown in "On" Position

Page 16 Part No. XG0106B
MD34-DV-2 Homefire
Maintenance
CAUTIONS
nFireplace gas control must be in the “OFF” position and pilot
and main burners extinguished when cleaning appliance
with a vacuum.
nDoors and logs can get very hot. Handle only when cool.
General
nHave the fireplace installation inspected yearly, including a
visual check of the vent system, the burner and the pilot flame.
For your convenience a 1/8" manifold pressure tap is supplied
on the gas valve for a test gauge connection. See Figure 28.
nFor Natural Gas this appliance requires a minimum inlet
pressure of 5.5" W.C. and a manifold pressure of .5" W.C.
nFor Propane Gas this appliance requires a minimum inlet
pressure of 11" W.C. and a manifold pressure of 10" W.C.
nAlways keep the fireplace area clear and free of combustible
materials, as well as gasoline and other flammable vapours and
liquids.
nDo not use this appliance if any part has been under water.
Immediately call a qualified service technician to inspect the
appliance and to replace any part of the control system and any
gas control which has been under water.
Operation
Lighting Instructions
See pages 14 and 15.
Cleaning
When the fireplace is first activated, there may be some smoking
and a visible film may be left on the glass. This is a normal
condition, and is the result of burning of protective coatings on new
metal.
nGlass must be cleaned periodically to remove any film (which is
a normal biproduct of combustion) which may be visible. Film
can easily be removed by removing the door, as shown on
page 1 . Handle the door carefully, and clean it with non-
abrasive glass cleaners. One of the most effective products is
Kel Kem.
nSilicone seals on inner door during initial firing will "off gas",
leaving a visual deposit of a white substance on combustion
chamber walls. This can easily be removed using normal
household products.
nUse a vacuum cleaner or whisk broom to keep the control
compartment, burner, and firebox free from dust and lint.
nLogs may be cleaned periodically with a vacuum to remove
soot or other contaminates. The logs are fragile and will break
easily. WARNING:
Do not attempt to clean glass when hot.
Do not clean glass with abrasive materials as any glass
etching may cause premature glass failure.
Adjusting the Burner
Raising or lowering the Flame Height
The MD 4-DV-2 fireplace is equipped with an adjustable burner,
allowing you to raise or lower the flames. Operating the control knob as
described below will adjust both the main burner and the ember burner.
nTo raise the flame height, turn the black knob (located behind the
lower trim) counterclockwise.
nTo lower the flame height, turn clockwise.
Gas Control Knob
(Shown in "Pilot" postion.)
Figure 27. Hi-Lo' Adjustment on the MD 4-DV-2's gas valve.

Page 17
Part No. XG0106B
MD34-DV-2 Homefire
Maintenance
Troubleshooting
If your fireplace still does not operate correctly, consult your dealer
or the manufacturer.
All service and repairs should be performed by a qualified
agency.
All spare parts, optional fans (see optional fan instruction guide),
and optional trim finishes are available from the manufacturer or
your local dealer.
HONEYWELL SV 9500 /SV9600
Troubleshooting Sequence
NOTE: Before Troubleshooting, Familiarize Yourself With
The Startup And Checkout Procedure.
· Turn Gas Supply off
· Set thermostat to
call for heat
SV9500/SV9600
is powered
(24 VAC nominal)
NO
NO
NO
NO
NO
YES
YES
YES
YES
YES
YES
YES
NO
NO
NO
START
Igniter warms up
and glows red.
Pilot Valve opens.
Turn gas on.
Pilot Burner lights?
Main Valve opens?
SYSTEM OK
Unplug Pilot Burner Cable,
Measure Voltage at
SV9500/SV9600 HSI
Terminals (24 VAC
Nominal, See INSET)
eplace Igniter/
Flame od Assembly.
eplace Igniter/
Flame od Assembly.
eplace SV9500/SV9600
Measure Voltage to SV9500
/SV9600. Voltage must
be at least 19.5 VAC
Discard old Igniter/
Flame od Assembly.
eplace Igniter/Flame
od Assembly and retain.
estart Troubleshooting
Sequence. Does main
valve open?
eplace
SV9500/
SV9600
Check
Transformer
Line Volt
Supply
eplace
SV9500/
SV9600.
Save old
Igniter/Flame
od Assembly
for service.
INSET
HSI
Terminals
CHECK:
· Line voltage power
· Low voltage transformer
· Limit Controller
· Thermostat
· Wiring
· Air proving switch on
combustion air blower system
· Vent damper (if used) is open
and end switch made
Gas Control Valve
Figure 28. Sit Nova 820 gas valve.
Pilot Burner Adjustment
1. Locate Pilot Adjustment Screw. (See figure 28.)
2. Adjust pilot screw to provide properly sized flame as shown in
figure 29).
3. After installing or servicing, leak test with a soap solution with
main burner on. Coat pipe and tubing joints, gasket etc. with
soap solution. Bubbles indicate leaks. Tighten any areas where
the bubbles appear until the bubbling stops completely.
MD34-DV-I-2
Figure 29. Pilot Burner
Troubleshooting
The following is a troubleshooting chart of possible problems:
PROBLEM CORRECTIVE ACTION
Noisy Pilot Flame Locate pilot adjustement screw on
gas control valve. Flame is de-
creased by turning adjustment screw
clockwise.
Pilot won’t ignite Disconnect remote wires and try to
light pilot. If pilot now works, remote
connections are faulty. Check wiring
diagram figure 28.
Main burner will 1. Check wiring (see figure 28).
not light 2. Check wall switch for proper
connection.
MD34-DV-2
Manifold Pressure
Test Connection
Pilot Adjustment Screw
Inlet
Pressure
Power
Generator
Wall Switch

Page 18 Part No. XG0106B
MD34-DV-2 Homefire
The WThe W
The WThe W
The Warrantyarranty
arrantyarranty
arranty
The Companies warrants the Montigo Gas Appliance to be free from defects in materials and workmanship at the time of manufacture. On the Montigo, there is a ten-
year warranty on the firebox and its components, a five-year warranty on the main burner, and a one-year warranty on the pilot burner, gas control valve and fibre
logs. Glass, plated/painted finishes, and refractory lining are exempt.
Remedy And Exclusions
The coverage of this Warranty is limited to all components of the Gas Appliance manufactured by The Companies.
This Warranty only covers Montigo Gas Appliances installed in the United States or Canada.
If the components of the Gas Appliance covered by this Warranty are found to be defective within the time frame stated (see The Companies right of investigation
outlined below). The Companies will, at its option, replace or repair defective components of the Gas Appliance manufactured by The Companies at no charge, and
will also pay for reasonable labour costs incurred in replacing or repairing components. If repair or replacement is not commercially practical, The Companies will,
at its option, refund the purchase price of the Montigo Gas Appliance.
This Warranty covers only parts and labour as provided above. In no case shall The Companies be responsible for materials, components, or construction which
are not manufactured or supplied by The Companies, or for the labour necessary to install, repair or remove such materials, components or construction. All
replacement or repair components will be shipped F.O.B. the nearest The Companies factory.
Qualifications To The WarrantyQualifications To The Warranty
Qualifications To The WarrantyQualifications To The Warranty
Qualifications To The Warranty
The Gas Appliance Warranty outlined above is further subject to the following qualifications:
(1) The Gas Appliance must be installed in accordance with The Companies installation instructions and local building codes. The Warranty on this Montigo Gas
Appliance covers only the component parts manufactured by The Companies. The use of components manufactured by others with this Montigo Gas Appliance
could create serious safety hazards, may result in the denial of certification by recognized national safety agencies, and could be in violation of local building
codes. This warranty does not cover any damages occurring from the use of any components not manufactured or supplied by The Companies
(2) The Montigo Gas Appliance must be subjected to normal use. The Gas Appliances are designed to burn gas only. Burning conventional fireplace fuels such
as wood, coal or any other solid fuel will cause damage to the Gas Appliance, will produce excessive temperatures and will result in a fire hazard.
Limitations On LiabilityLimitations On Liability
Limitations On LiabilityLimitations On Liability
Limitations On Liability
It is expressly agreed and understood that The Companies sole obligation, and purchaser's exclusive remedy under this Warranty, under any other warranty,
expressed or implied, or in contract, tort or otherwise, shall be limited to replacement, repair, or refund, as specified above.
In no event shall The Companies be responsible for any incidental or consequential damages caused by defects in its products, whether such damage occurs or
is discovered before or after replacement or repair, and whether or not such damage is caused by The Companies negligence. Some states do not allow the exclusion
or limitation of incidental or consequential damages, so the above limitation or exclusion may not apply to you. The duration of any implied warranty with respect
to this Montigo Gas Appliance is limited to the duration of the foregoing warranty. Some states do not allow limitation on how long an implied warranty lasts, so the
above may not apply to you.
Investigation Of Claims Against WarrantyInvestigation Of Claims Against Warranty
Investigation Of Claims Against WarrantyInvestigation Of Claims Against Warranty
Investigation Of Claims Against Warranty
The Companies reserves the right to investigate any and all claims against this Warranty and to decide upon method of settlement.
The Companies Are Not Responsible For Work Done Without Written Consent
The Companies shall in no event be responsible for any warranty work done without first obtaining The Companies written consent.
Dealers Have No Authority To Alter This Warranty
The Companies employees and dealers have no authority to make any warranties nor to authorize any remedies in addition to or inconsistent with those stated above.
How THow T
How THow T
How To Register A Claim Against Wo Register A Claim Against W
o Register A Claim Against Wo Register A Claim Against W
o Register A Claim Against Warrantyarranty
arrantyarranty
arranty
In order for any claim under this Warranty to be valid, The Companies must be notified of the claimed defect in writing or by telephone, as soon as reasonably possible
after the defect is discovered. Claims against this Warranty in writing should include the date of installation, and a description of the defect.
Other RightsOther Rights
Other RightsOther Rights
Other Rights
This Warranty gives you specific legal rights, and you may also have other rights which vary from state to state.
NOTE: The Companies as stated above refer to - Canadian Heating Products Inc. and/or Montigo Del Ray Corp.
Canadian Heating Products Inc. and/or Montigo DelRay Corp. reserves the right to make changes at any time, without
notice, in design, materials, specifications, prices and also to discontinue colors, styles and products.
Warranty

Page 19
Part No. XG0106B
MD34-DV-2 Homefire
Appendix A - Termination Locations
A= clearancetotheterminationframeabovegrade,veranda,porch,deck,or
balcony[16inches(41cm)minimum]
B= clearancetodoor,orsidesandtopofwindow,thatmaybeopened[16
inches(41cm)minimumforappliances
≤ 100000BTU/H(30kW)]
C= clearancetobottomof windowthatmaybeopenedhorizontally[36inches
(92cm)minimumforappliances
≤ 100000BTU/H(30kW)]
D= noclearancetopermanentlyclosedwindowwheninstalledwithapproved
glasspenetrationtermination
E= clearancetopermanentlyclosed window[16inches41cmrecommended
topreventcondensationonwindow]
F= verticalclearancetoventilatedsoffitlocatedabovetheterminationwithina
horizontaldistanceof2feet(61cm)fromthecentrelineofthetermination
[22inches(56cm)minimum]
G= clearancetounventilatedsoffit
[16inches(41cm)minimumtonon-combustibles]
[22inches(56cm)minimumtocombustibles]
H= clearancetooutsidecorner[9inches(23cm)minimum]
I= clearancetoinsidecorner[12inches(31cm)minimum]
J= *nottobeinstalledaboveameter/regulatorassemblywithin
40"(103cm)horizontallyfromthecentrelineoftheregulator
K= clearancetoserviceregulatorventoutlet[3feet minimumintheUnited
States][*6feet (1.8m)minimuminCanada]
L = clearancetononmechanicalairsupplyinlettobuildingorthecombustion
airinlettoanyotherappliance[16inches(41cm)minimumforappliances
≤ 100000BTU/H(30kW)]
M= clearancetomechanicalairsupplyinlet
[*6feet (1.8m)minimum]
N= †clearanceabovepavedsidewalkorapaveddrivewaylocatedon
publicproperty[*7feet(2.1m)minimum]
P= clearanceunderveranda,porch,deck,orbalcony
[16inches(41cm)minimum‡tonon-combustibles]
[22inches(56cm)minimum‡tocombustibles]
Q= clearanceabovearoof[24inches(61cm)minimum]
R= clearancetoadjacentwallsandneighbouringbuildings
[18inches(46cm)minimum]
S= clearancefromcornerinrecessedlocation
[12inches(31cm)minimum]
T= maximumdepthinrecessedlocation
[48inches(122cm)minimum]
U= minimumwidthforbackwallofrecessedlocation
[24inches(61cm)minimum]
V= nohorizontalclearancebetweentheframesoftwoterminationsthatare
level.
W= horizontalclearancebetweentheframesoftwoterminationsthatare
notlevel. [36inches(92cm)minimum]
†aventshallnotterminatedirectlyaboveasidewalkorpaveddriveway
whichislocatedbetweentwosinglefamilydwellingsandservesboth
dwellings
‡onlypermittedifveranda,porch,deck,orbalconyhasanopensidethat
isequaltoorgreaterthanthedepthoftheenclosedarea
*asspecifiedinCGAB149InstallationCodes.Note:localCodesor
Regulationsmayrequiredifferentclearances

Canadian Heating Products Inc.
Langley, BC V4W 4A1
Montigo Del Ray Corp.
Ferndale, WA 98248
XG0106B Rev. 07 - 07/02