Curtis DPF828 User manual

Digital Photo Frame
MODEL NO: DPF828

Contents
Welcoming to Using the Product………………..…..…..
Features…………………………………………..………....….
Back Panel Layout…………………………………….…….
Remote control…………………………………...……….….
Preparation for use…………………………...…………..….
1. Initial setup……………………………………………........….
2. Operation with cards…………………………………....….….
3. Main interface………………………………………….......….
Basic Operation .........…………………….....……..…...….
1.Photo Function ……………………………………………......
2.Music Function…………………………………………….......
3.Movie Function……………………………………………......
4.Calendar ……………………………………………......….….
5. System Setup ………………………………………….…........
Option of General…………………………………………..…….
Option of Display……………………………………………..….
Option of Image…………………………………………….........
Option of Time……………………………………………......….
Option of Device …………………………………………….......
Specifications………………………………...…….......…….
Accessories………………………………………...….…..….
Troubleshooting………………………………....…….....….
1
2
2
3
5
5
5
6
6
6
7
7
8
8
8
9
9
10
11
12
12
12

1
Welcome to using Digital Photo Display
Precautions
Please read through all materials attached to your Digital Photo Display
before you use the device. Introducing all functions performed by the
device, this User’s Manual will make facilitate you to use the product.
With it, you will better understand the device and its operations.
Keep children away from this device.
Do not use this device in environment that is excessively hot, cold, dusty
or wet.
Keep the device away from water.
Never drop down the device, or strike it onto hard object. Otherwise, its
surface may be scratched or parts damaged.
Never attempt to take part or rebuild the device. Otherwise, the warranty
clauses for it may become void.
Do not use chemical agent or cleaning agent to clean the device. This may
damage the s surface of the device.
Do not connect this device to overloaded power supply. Do not bend the
power cord or place heavy object onto it. Otherwise, excessive heat may
be generated to cause fire.
To avoid electric shock, never plug or unplug the power cord with a wet
hand.
Unplug the power cord when the device is not used.
Some words or particulars inside this Manual are presented in a special
way. The related introductions are as follows:
【Caution】To present information which require your special attention.
If it is not followed, some data may be lost, functions not performed or
machine damaged.
【Advice】To provide supplementary information for maintenance of the
device.
【Tip】To provide referential information.
Pictures in this Manual are only used for reference and the physical object
should prevail!

Features
Screen: 8-inch TFT screen for displaying.
Playing picture: Supports pictures with JPEG, BMP and GIF formats.
Playing audio files: Supports audio files with MP3 and WMA formats.
Playing video files: Playing video files with Mpeg1, Mpeg2 and
Mpeg4 standards, with high quality.
Memory card compatible: Supports U disk, SD/MMC/MS and other
memory cards, for viewing the pictures and video in the disk or card, or
playing the audio files saved in them.
Calendar: Time system shifts between 12H mode and 24H mode, alarm
clock available.
Remote control: Supports IF remote operation to make your operations
easier.
Special functions: Automatic playing, full-screen displaying, zoom-out
viewing and other picture formats. The playing of background audio files
is supported.
Left and right speakers: Built-in speakers.
Back Panel Layout
(1) Standby
(2) Up: In background audio files or video mode, press it to go back to the
previous track
(3) Play/Pause/OK: Press and hold down this key to return to the main menu
(4) Right: In background audio files or video mode, press it to turn down the
volume
81
9
10
2
3
45
6
7

(5) Left: In background audio files or video mode, press it to turn up the
volume
(6) Down: In background audio files or video mode, press it to go back to
the next track
(7) Function: Press and hold down this key to set up through the menu
(8) SD/MMC/MS card’s interface
(9) USB Host’s interface
(10) DC In interface
Remote Control

4
Key Description Function
Power To start up the device
Playing pictures To allow the device to be in
picture-playing mode
Mute To allow the device to be in
mute mode
Menu To reach the menu
Video To play the video files
Audio Toplaytheaudiofiles
Picture+Audio files To play pictures and audio files
Exit To exit the current state
OK To select/confirm
Up To select upward
Down To select downward
Right To select rightward
Left To select leftward
Function To switch over functions
Volume- Toturndownthevolume
Volume + To turn up the volume
Setup To set up
Calendar To view the pictures with
calendar information
Zoon out To zoom out the image
Zoon in To zoom in the image
Rotate To rotate the pictures
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
sequence
number

5
Preparation for use
1. Initial setup
This Digital Photo Display can be horizontally placed or hung where you
desire in the room and serve as a photo display, MP3 player or MP4 player
after connected to power supply.
,QVWDOOLQJWKHEUDFNHWRIWKH'LVSOD\
+ROGWKHKRVWZLWK\RXUOHIWKDQGDQGLQVHUWWKHIURQWHQGRIWKHEUDFNHW
LQWRWKHEUDFNHWVORW7KHQWXUQULJKWZDUGJHQWO\WRPDNHWKHEUDFNHW
fixed onto the body.
&RQQHFWLQJWRSRZHUVXSSO\
Insert one end of the power cord into the receptacle, and another end to
the device.
6WDUWLQJXS
After the power supply is properly connected, the start-up animation
will appear on the screen. The main interface will appear seconds later.
2SHUDWLRQWKURXJKNH\V
7KLVGHYLFHLVRSHUDWHGWKURXJKWKHNH\VVHWRQLWVEDFN)XQFWLRQVRI
each can be viewed on the screen.
【Tip】Information on operations through the remote control should
prevail in this Manual.
2SHUDWLRQZLWKFDUGV
$FFRUGLQJWRWKHSRVLWLRQRIWKHSRUWXVHGIRUDFFHSWLQJWKHPHPRU\
card, properly insert the card whose pictures or multimedia files need to
be read.
$XWRPDWLFLGHQWLILFDWLRQRIPDFKLQH<RXFDQLQVHUW86%GHYLFHDQG
RQHRI6'00&06FDUGVVLPXOWDQHRXVO\
8VHWKHNH\VRQWKHPDFKLQHRU³OHIW´³ULJKW´³GRZQ´³XS´RQWKH
UHPRWHFRQWUROWRVHOHFWWKHGHVLUHLWHPDQGWKHQSUHVV2.WRUHDFK
the next menu.
【&DXWLRQ】:KHQWKHPHPRU\FDUGLVUXQQLQJLQWKHGHYLFHOLNHWKHGDWD
DUHEHLQJUHDGGRQRWSXOORXWWKHFDUG2WKHUZLVHWKHGDWDLQLWPD\EH
wrongly read.

3. Main interface
Device domain Media type domain
Folder domain
File domain
Device domain Media type domain
Folder domain
File domain
Basic Operation
In the main interface, use the , , and buttons to choose the desired item and
press the OK button to enter the corresponding function.
[Tips] When entering the main interface, if you insert SD or MMC or MS and USB into the device,
firstly you need to choose to enter the SD/MMC/MS or USB, use , buttons to choose
the desired card and press OK button to enter.
1Photo Function
After choosing “Photos”, the device will display the photo preview mode. You can use the
, , and buttons to choose your desired item
and then press the OK button to start automatic circular
play (defaulted) of every photo. Whiling browsing such
photo, you may adjust its size by pressing the zoom-in/
out buttons. To view the local portion of the photo
enlarged, press the FUNC button to enter and press the
Navigation button to move such photo, and press the
FUNC button again to back. Press the BACK button to
back to the preview mode. In the preview mode or
full-screen play, you can back to the main interface with
the MAIN INTERFACE button.
[Tips]: In photo full-screen play, you may press the FUNC button to eject the photo display
mode window; with the and buttons, you can choose different photo display mode,
and press the OK key to confirm.

2 Music Function
After entering “Music”, you can have a tracklist. With
and buttons, you can choose your favorite music;
and press the OK button to start the play of the
selected music. In the play interface, the defaulted play
order is Repeat All. Under such option, press the
FUNC button to switch button function, press the
button to choose the desired music cycle mode, such
as Repeat All, Play All, Random, Repeat
One, Folder recycle; press the button to choose the
desired sound stage effect, such as Normal, Rock,
Classic, Jazz, Pop,Studio, Ballad, Club, R&B, Dance.
To back the music selection menu, press the FUNC
button. In play, press the FUNC button to switch to the play operation window on the right.
In the play window, press the , buttons to move the cursor and then the OK key to
confirm the play state; press the button to pause, button to stop, button to restore,
or button to fast forward or fast backward, or button to choose the
previous or the next piece of music in order; and press the FUNC button to back to
function switching.
[Tips]: In music play, you can press Photo + Music buttons to enter photo and music play
so that you can enjoy photos while listening to music.
3. Movie Function
After entering “Movies”, The unit begin to play the first
movie.
you can use the or button to choose your
desired movie and press the OK button to start the
play of the selected movie in full screen.
In full-screen play, press the BACK button to back to
the video browse interface. you can see a movie list,
window on the right. In the play window, press the
, buttons to move the
cursor; press the button to pause, button to stop,
button to restore, or button to fast forward
or fast backward, or button to choose the previous or the next movie in order;
button to play the movie in full screen; after choosing the desired video cycle mode,
press the OK button to confirm. In the play window, you can choose movie cycle mode with
the button on the remote controller to choose the desired movie cycle mode, such as
Repeat All, Play All, Random, Repeat One, Folder recycle; press the button
to choose the desired sound stage effect, such as Normal, Rock, Classic, Jazz, Pop,
Studio, Ballad, Club, R&B, Dance. To back the movie selection menu, press the FUNC
button
Press the FUNC button to switch to the play operation

4. Calendar
Enter “Calendar”, then you can see calendar and photos.
In Clock Calendar state, press the FUNC button to enter the photo display mode window,
with the or button, you can choose different photo display mode,; press the OK
button to confirm.
5. System Setup
In System Setup, you can have more internal setups and advanced functions, which can
be realized via system menus. Press the Setup button to display setting menu, which
includes such submenus as General, Display, Image, Time, Photo Edit and Device. For the
operation on the functions of the setup menu, please refer to the main button functions
corresponding to the remote controller and adjust the setup menu as the case may be.
Switches confirmation in photo
editing .
Confirms
Backs to the previous menu.
Sets menu on/off
Move the cursor up and
down
Move the cursor left and
right
Option of General
Item Instruction
Language Sets the OSD language.
Power on Sets the Power on Mode.
Button sound Sets the Button Sound Mode.
Movie Movie display mode .
Version View the information of the DP frame.
NOTE: For SETUP procedures:
1. Press setup button on the remote control, then press "BACK" button , use
navigation buttons to choose UP/DOWN/LEFT/RIGHT to select your
preferred setup item
2. Press "OK" button to confirm
3. Press LEFT/BACK button to exit setup manual.

Option of Display
Option of Image
Item Instruction
LCD setting Adjust screen contrast
/backlight/brightness/color.
Select the desired option
and then press the OK
button to confirm, press the
UP/DOWN button to adjust.
For LCD setup, you can set contrast, backlight, brightness and color. You can conduct the
setup according to your color and brightness interest and the setup scope includes 10
levels totally.
In this menu, you can set image slide duration as 3s/5s/10s, set background music as
on/off, set slide mode, slide order and slide effect and layout mode as 4*4frames/5*5frames
Item Instruction
genera Sets the Slide Duration BG Music Display Mode Slide
Order.
Slide Effect Sets the Slide Effect.
Explore Sets the Layout Mode.

Option of Time
Item Instruction
Date&Time
Auto Power
Alarm
1、To set a date/time: select the yy-mm-dd/Time option
and press the OK button to confirm, and then
press the UP/DOWN button to select the desire
date/time. Press the OK button to confirm.
2、Sets the time Mode to 12 or 24 hours
To set a Power On/Off Time:
To set the power on/off frequency: select Repeat
option and press the OK button, and then select
and confirm the desired option.
To set the time: select Power on/off time option, and
then press the OK button to confirm. Press the
UP/DOWN button to select the desire time. Press
the OK button to confirm.
To set an Alarm Time:
To set the Alarm frequency: select Repeat option
and press the OK button, and then select and
confirm the desired option.
To set an alarm time: select Time Settings option,
and then press the OK button to confirm. Press
the UP/DOWN button to select the desire time.
Press the OK button to confirm.
To set the alarm tone: Select and confirm the Sound
option, and then select and confirm the desired
sound option.
Press any button to interrupt the alarm before it
resumes a few minutes later. Press OK button to stop
alarming compleletly.

Option of Device
Item Instruct ion
Firmware Update Type Sets the update type.
From Device Update from memory device installed on
this digital photo frame.
Reset Resets all settings to their factory default state.

12
Specifications
Displaying: 8-inch TFT LCD screen (definition: 800*600)
Power supply: DC 5V/1.2A
Ports: SD/MMC/MS interface
USB interface
DC power port
File format: Picture: JPEG *.jpg
BMP *.bmp
GIF *.gif
Music: MP3 *.mp3
WMA * .wma
Video: DivX *.avi
MPEG1/ MPEG2 /MPEG4 *.mpg
Operating temperature: 5-35°C (30~80[%RH])
Storage temperature: -10~55°C (5~80[%RH])
Accessories
Troubleshooting
Item
No.
Failure Solution
1 Can’t turned on Check whether the power supply is
properly connected to the device.
2 Can’t read the contents in the
memory card sometimes
The device is not compatible with the
memory card you insert.
3 Remote control doesn’t work You may have kept the remote control too
far from the device. You should get the
remote control closer to the IF port on the
device.
4. No sound is heard when audio
file or video file is played
(1) Check whether there is audio output;
(2) Check the remote control to see if the
mute state is enabled. If so, press the
Mute key again.
1. User’s Manual
2. Remote control
3. Power adapter
Table of contents
Other Curtis Digital Photo Frame manuals

Curtis
Curtis DPF712 User manual

Curtis
Curtis DPB770 User manual

Curtis
Curtis DPF768 User manual

Curtis
Curtis DPF771 User manual

Curtis
Curtis DPF768 User manual

Curtis
Curtis DPF151 Operation manual

Curtis
Curtis DPF151 User manual

Curtis
Curtis DPF716 User manual

Curtis
Curtis DPF711 User manual

Curtis
Curtis DPF247 Operation manual

Curtis
Curtis DPF350 User manual

Curtis
Curtis Digital Phot frame DPF770 User manual

Curtis
Curtis DPB702 User manual

Curtis
Curtis DPF151 User manual

Curtis
Curtis DPF710 User manual

Curtis
Curtis DPF247 User manual

Curtis
Curtis DPF316 User manual

Curtis
Curtis DPF7250UK User manual

Curtis
Curtis DPB702A User manual

Curtis
Curtis DPB701 User manual