INVENTOR XK60 User manual

Your-conditions
Ενσύρματο Τηλεχειριστήριο XK60
Wired Controller XK60
English/Ελληνικά/ Româna

User Notice
Please carefully read this manual before installation and use of this product
ƹThanks for choosing Inventor duct type air conditioners. Please read this manual carefully
before operating this product and keep it properly for future reference. In addition, please
take notice of the symbols below.
WARNING! This mark indicates procedures which, if improperly performed, might lead to
the death or serious injury of the user.
CAUTION! This mark indicates procedures which, if improperly performed, might possibly
result in personal harm to the user, or damage to property.
CAUTION!
(1). Do not install the wired controller in the damp place or under direct sunlight.
(2). Do not beat, toss, or frequently assemble/disassemble the wired controller.
(3). 'RQRWRSHUDWHWKHZLUHGFRQWUROOHUZLWKZHGKDQGVDQGQHYHUOHWDQ\OLTXLGÀRZLQWRLW
(4). Do not install or remove the wired controller by yourself. If necessary, please contact the after-
sales serviceman.
(5). 7KLVZLUHGFRQWUROOHULVDSSOLFDEOHWRYDULRXVNLQGVRIDLUFRQGLWLRQHUVZKLOHVRPHVSHFL¿FIXQFWLRQV
unavailable to the duct type air conditioners will not be covered in this manual.
(6). Before operating the air conditioner, please read this manual carefully and keep it properly for
future reference.

1 Introduction to the Wired Controller.................................................................1
1.1 Appearance and LCD Icons .......................................................................1
1.2 Introduction to the LCD Icons.....................................................................2
2 Press Buttons..................................................................................................4
2.1 Buttons.......................................................................................................4
2.2 Instruction to the Function of Press Buttons...............................................4
3 OPERATION INSTRUCTION .........................................................................5
3.1 On/off..........................................................................................................5
3.2 Mode Setting..............................................................................................5
3.3 Temperature Setting...................................................................................6
3.4 Fan Speed Setting......................................................................................6
3.5 Right and Left Swing..................................................................................7
3.6 Up and Down Swing...................................................................................8
3.7 Timer Setting..............................................................................................8
3.8 Air Exchange Setting..................................................................................9
3.9 Sleep Setting............................................................................................11
3.10 Health Setting........................................................................................13
3.11 I-Demand Setting....................................................................................13
3.12 Vacation Setting.....................................................................................14
3.13 Turbo Function Setting...........................................................................15
3.14 SAVE Function Setting...........................................................................16
Contents

3.15 E-HEATER Setting .................................................................................18
3.16 Blow Function Setting.............................................................................18
3.17 Filter Setting...........................................................................................19
3.18 Quiet Function Setting .......................................................................21
3.19 Ultra-Dry Setting ....................................................................................22
3.20 Other Functions......................................................................................22
4 Installation of the Wired Controller ...............................................................23
4.1 Standard Parts .........................................................................................23
4.2 Installation Location and Installation Requirements ................................23
4.3 How to Install the Wired Controller...........................................................24
4.4 How to Remove the Wired Controller.......................................................25
5 Error Display.................................................................................................25

Wired Controller XK60
1
1 Introduction to the Wired Controller
Fig.1 Appearance of the Wired Controller
1.1 Appearance and LCD Icons
Fig.2 Appearance of the LCD

Wired Controller XK60
2
1.2 Introduction to the LCD Icons Table 1
No. Icons Introduction
1Left and right swing function
2Up and down swing function
3Air exchange function
4Sleep function
5Auto mode
6COOL mode
7DRY mode
8FAN mode
9HEAT mode
10 Health function
11 I-Demand function
12 Vacation function
13 Status display of master and slave wired controller
14 Shield function
The button operation, temperature setting, "On/Off" operation, "Mode"
setting, and "Save" setting are disabled.
15 Fan speed
16 Memory function
The unit will resume the original setting state after power recovery.
17 Turbo function
18 Energy-saving function
19 Ambient/setting temperature

Wired Controller XK60
3
20 Electric heater
21 Blow function
22 Defrosting function
23 Filter cleaning
24 Timer Setting
25 Keycard control / Detected status sensed by human body
26 Quiet function
27 Lock function

Wired Controller XK60
4
2 Press Buttons
2.1 Buttons
Fig.3 Press Buttons
2.2 Instruction to the Function of Press Buttons
Table 2
No. Press Buttons Function Introduction
1 Enter/Cancel ķ
Function selection and canceling;
ĸ
Press it for 5s to enquiry the outdoor and indoor ambient temperature.
2Ÿ
ķ
Running temperature setting of indoor unit, range :16~30°C
ĸ
Timer setting, range:0.5-24hr
Ĺ
Air function setting
ĺ
Save setting
Ļ
Clean setting
6ź
3Fan
Select fan speed from high, mid-high, middle, mid-low, low and auto
levels.
4 Mode Selection of the COOL, HEAT, FAN or DRY mode.
5 Function Switchover among these functions of SWING/AIR/SLEEP/HEALTH/
I-DEMAND/VACATION/TURBO/SAVE/E-HEATER/BLOW/QUIET
7 Timer Timer setting
8 On/Off Turn on/off indoor unit
4 mode
DQGŸ Memory
3UHVV0RGHDQGŸDWWKHVDPHWLPHIRUVXQGHUWKH2))VWDWHRIWKH
unit to activate/deactivate memory function (If memory is set, indoor unit
will resume original setting state after power recovery. If not, indoor unit is
defaulted to be OFF after power recovery. Memory function is defaulted to
be ON)
Ÿ
DQGź Lock
Under the ON state of the unit without any malfunction or under the OFF
VWDWHRIWKHXQLWSUHVVŸDQGźEXWWRQVDWWKHVDPHWLPHIRUVWRJRWR
the lock state. In this case, any other buttons won’t respond the press.
5HSUHVVŸDQGźDJDLQIRUVWRTXLWWKHORFNVWDWH
4 mode
DQGź °F/°C 8QGHUWKH2))VWDWHRIWKHXQLWSUHVVWKH0RGHDQGźDWWKHVDPHWLPH
for 5s to switch the temperature scale between Celsius and Fahrenheit.

Wired Controller XK60
5
3 OPERATION INSTRUCTION
3.1 On/off
Press the On/Off button to turn on or off the unit.
Notes:
ķ
The state shown in Fig.4 indicates the OFF state of the unit after energization.
ĸ
The state shown in Fig.5 indicates the ON state of the unit after energization.
Fig.4 OFF State of the Unit Fig.5 ON State of the Unit
3.2 Mode Setting
Under the ON state of the unit, press the Mode button to switch the operation modes as the
sequence shown in Fig.6:
Auto Cooling Dry Fan Heating
Fig.6

Wired Controller XK60
6
3.3 Temperature Setting
3UHVVŸRUźEXWWRQWRLQFUHDVHRUGHFUHDVHVHWWLQJWHPSHUDWXUHXQGHURQVWDWHRIWKHXQLW,I
press either of them continuously, temperature will be increased or decreased by 1°C every 0.5s.
In Cooling, Dry, Fan and Heating mode, temperature setting range is 16°C~30°C.
In Auto mode, the setting temperature is un-adjustable.
As shown in Fig.7:
Fig.7 Temperature Setting
3.4 Fan Speed Setting
Press Fan button, fan speed of indoor unit will change as the sequence shown in Fig.8:
Low Mid-low Mid-highMiddle High Super-high Auto
Fig.8 Fan Speed Setting

Wired Controller XK60
7
3.5 Right and Left Swing
Under the ON state of unit, press the Function button to select the “Right and Left Swing”
function option and then press the Enter/Cancel button to activate it.
When the Swing function is activated, press the Function button to select the "Right and Left
Swing" function option and then press the Enter/Cancel button to deactivate it.
Right and Left Swing function setting is as shown in Fig.9.
Unit On, no left-right swing Press “Function” button to set
left-right swing function
Press “Enter/Cancel” button to
activate left-right swing function
Press “Function” button to set
left-right swing function
Press “Enter/Cancel” button to
cancel left-right swing function
Fig.9 Right and Left Swing Setting

Wired Controller XK60
8
3.6 Up and Down Swing
Under the ON state of unit, press the Function button to select the "Up and Down Swing"
function option and then press the Enter/Cancel to activate it.
When the Swing function is activated, press the Function button to select the "Up and Down
Swing" function option and then press the Enter/Cancel button to deactivate it.
Up and Down Swing function setting is as shown in Fig.10.
Unit On, no up-down swing Press “Function” button to set
up-down swing function
Press “Enter/Cancel” button to
activate up-down swing function
Press “Function” button to set
up-down swing function
Press “Enter/Cancel” button to
cancel up-down swing function
Fig.10 Up and Down Swing Setting
3.7 Timer Setting
Timer “On” Setting:
It is intended to set when to start the unit. When the unit is OFF, press the Timer button, with
[[+RXUGLVSOD\HGDQG21EOLQNLQJWKHQSUHVVŸźWRDGMXVWWKHWLPHUDIWHUWKDWSUHVVWKH7LPHU
EXWWRQDJDLQWRPDNHDFRQ¿UPDWLRQ,IWKH0RGHEXWWRQLVSUHVVHGSULRUWRWKHFRQ¿UPDWLRQLWZLOO
switch to the Timer Off setting. After the timer Off setting, the LCD displays xx. Hour ON OFF,xx.
Hour indicating the time to start the unit, while the time to stop the unit won’t be displayed.
Timer “Off” Setting:
It is intended to set when to stop the unit. When the unit is On, press the Timer button, with xx.
+RXUGLVSOD\HGDQG2))EOLQNLQJWKHQSUHVVŸźWRDGMXVWWKHWLPHUDIWHUWKDWSUHVVWKH7LPHU
EXWWRQDJDLQWRPDNHDFRQ¿UPDWLRQ,IWKH0RGHEXWWRQLVSUHVVHGSULRUWRWKHFRQ¿UPDWLRQLWZLOO
switch to the Timer On setting. After the timer On setting, the LCD displays xx. Hour ON OFF,xx.
Hour indicating the time to stop the unit, while the time to start the unit won’t be displayed.

Wired Controller XK60
9
Cancellation of Timer Setting: The timer setting can be canceled by press “Timer”. Then , xx.
Hour won’t be displayed.
Timer Setting under the ON state of the Unit is as shown in Fig.11:
Unit On, no timer function Press “Timer” button to set
timer off adjust timer time
Press “Mode” button to set
timer on
adjust timer time
Press “timer” button to activate
timer function
Fig.11 Timer Setting under the ON state of the Unit
7LPHUUDQJHKU(YHU\SUHVVRIWKHŸRUźEXWWRQZLOOPDNHWKHVHWWLQJWLPHLQFUHDVHGRU
decreased by 0.5hr.If press either of them continuously, the setting time will automatically increase/
decrease by 0.5hr every 0.5s.
Notes:
ķ
When Timer On and Timer Off both are set, the displayed time is the Timer On setting for
the unit under the OFF state , or is the timer Off setting for the unit under the ON state .
ĸ
Timer On setting starts when the unit under the ON state is turned off; Timer Off setting
starts when the unit under the OFF state is turned on.
3.8 Air Exchange Setting
How to activate the air exchange function:
Under the ON state of the unit, press the Function button to select the “AIR” function, with
WKHIXQFWLRQV\PEROÀDVKLQJDQGWKHQSUHVVŸRUźWRDGMXVWWKH³$,5´W\SHDIWHUWKDWSUHVVWKH
Enter/Cancel button to activate this function. When this function is activated, the symbol will be
displayed. Type 1 is the defaulted “AIR” type.
There are 10 “AIR” function types , but only 1-2 types are for the wireless remote controller.

Wired Controller XK60
10
ʊʊ7KHXQLWFRQWLQXRXVO\UXQVIRUPLQDQGIUHVKDLUYDOYHUXQVIRUPLQ
ʊʊ7KHXQLWFRQWLQXRXVO\UXQVIRUPLQDQGIUHVKDLUYDOYHUXQVIRUPLQ
ʊʊ7KHXQLWFRQWLQXRXVO\UXQVIRUPLQDQGIUHVKDLUYDOYHUXQVIRUPLQ
ʊʊ7KHXQLWFRQWLQXRXVO\UXQVIRUPLQDQGIUHVKDLUYDOYHUXQVIRUPLQ
ʊʊ7KHXQLWFRQWLQXRXVO\UXQVIRUPLQDQGIUHVKDLUYDOYHUXQVIRUPLQ
ʊʊ7KHXQLWFRQWLQXRXVO\UXQVIRUPLQDQGIUHVKDLUYDOYHUXQVIRUPLQ
ʊʊ7KHXQLWFRQWLQXRXVO\UXQVIRUPLQDQGIUHVKDLUYDOYHUXQVIRUPLQ
ʊʊ7KHXQLWFRQWLQXRXVO\UXQVIRUPLQDQGIUHVKDLUYDOYHUXQVIRUPLQ
ʊʊ7KHXQLWFRQWLQXRXVO\UXQVIRUPLQDQGIUHVKDLUYDOYHUXQVIRUPLQ
ʊʊ7KHXQLWFRQWLQXRXVO\UXQVIRUPLQDQGIUHVKDLUYDOYHDOZD\VUXQV
How to deactivate the air exchange function:
When the “Air” function is activated, it can be deactivated in the way by firstly pressing the
)XQFWLRQEXWWRQWRVHOHFWWKH³$LU´IXQFWLRQRSWLRQZLWKWKH³$LU´V\PEROÀDVKLQJDQGWKHQSUHVVLQJ
the Enter/Cancel button with the “Air” symbol disappeared.
Air Exchange setting is shown as in Fig.12:
Unit On, no Air function Press “Function” button to set
air function adjust air mode
Press “Enter/Cancel” button to
activate air function
Press “Function” button to
set air function
Press “Enter/Cancel” button
to cancel air function
Fig.12 Air Exchange Setting

Wired Controller XK60
11
3.9 Sleep Setting
Sleep on: Press the Function button under the ON state of the unit to select the “Sleep” function
option and then press the Enter/Cancel button to activate it.
Sleep off: When the Sleep function is activated, press the Function button to select the Sleep
function option and then press the Enter/Cancel button to deactivate this function.
Sleep setting is as shown in Fig.13 :
Unit On, no Sleep function Press “Function” button to set
sleep function
Press “Enter/Cancel” button to
activate sleep function
Press “Function” button to
set sleep function
Press “Enter/Cancel” button to
cancel sleep function
Fig.13 Sleep Setting
Notes:
ķ
The Sleep function is defaulted to be OFF after power recovery.
ĸ
The Sleep function is unavailable under the Fan mode.
Ĺ
When the Quiet function is activated, the Quiet function will always keep ON no matter if the
Sleep function is activated or deactivated.
ĺ
Under the Cool mode, the Sleep function is ON, the setting temperature range can be
16~23°C, 24~27°C, 28~29°C or 30°C. Each of them has a different curve as shown in
Fig.14.

Wired Controller XK60
12
e.g. If the setting temperature is 25°C, the temperature will rise by 1°C in each hour until it
reaches 27°C. 7 hours later, the temperature will drop to 26°C. After that, the unit will run at this
temperature.
7HPSć
7LPHKRXU
Fig.14 Sleep Curve under the COOL Mode
Under the Heat mode, the Sleep function is ON, the setting temperature range can be 16°C,
17~20°C, 21~27°C or 28~30°C. Each of them has a different curve as shown in Fig.15.
e.g. If the setting temperature is 22°C, the temperature will drop by 1°C in each hour until it
reaches 20°C. Then, the unit will run at this temperature
7HPSć
7LPHKRXU
Fig.15 Sleep Curve under the HEAT Mode

Wired Controller XK60
13
3.10 Health Setting
Under unit on status, press “Function” button to select health function with “Health” icon
ÀDVKLQJ3UHVV³(QWHU&DQFHO´EXWWRQWRDFWLYDWHKHDOWKIXQFWLRQ
:KHQKHDOWKLVRQSUHVV³)XQFWLRQ´EXWWRQWRVHWIXQFWLRQZLWK³KHDOWK´LFRQÀDVKLQJ7KHQ
press the “Enter/Cancel” button to cancel health function.
How to set health function is shown in the Fig.16:
Unit On, no Health function Press “Function” button to
set health function
Press “Enter/Cancel” button to
activate health function
Press “Enter/Cancel” button to
cancel health function
Press “Function” button to set
health function
Fig.16 Health Setting
Note:
ķ
The health function can be cancelled by turning off the unit.
ĸ
The health function can not be cancelled by mode switching.
Ĺ
After the unit is resumed, health function will be maintained.
3.11 I-Demand Setting
Under cooling mode, press “Function” button to select I-Demand function with “I-Demand” icon
ÀDVKLQJ3UHVV³(QWHU&DQFHO´EXWWRQWRDFWLYDWH,'HPDQGIXQFWLRQ
:KHQ,'HPDQGLVRQSUHVV³)XQFWLRQ´EXWWRQWRVHWIXQFWLRQZLWK³,'HPDQG´LFRQÀDVKLQJ
Then press the “Enter/Cancel” button to cancel I-Demand function.
How to set I-Demand function is shown in the Fig.17:

Wired Controller XK60
14
Press “Function” button to set
I-Demand function
Unit On, no I-Demand function Press “Enter/Cancel” button to
activate I-Demand function
Press “Function” button to set
I-Demand function
Press “Enter/Cancel” button to
cancel I-Demand function
Fig.17 I-Demand Setting
Note:
ķ
The I-Demand function can be cancelled by mode switch and unit ON/OFF.
ĸ
After the unit is resumed, I-Demand function will be maintained.
Ĺ
The I-Demand function can not be simultaneously set and can be cancelled by Sleep/Quiet
function.
ĺ
When the I-Demand function is set, the unit will run as per Auto fan speed. The Turbo fan
speed is not available.
Ļ
When the I-Demand function is set, the setting temperature 27°C can not be changed.
ļ
When the setting temperature is shielded by the remote control, I-Demand function can not
be entered.
3.12 Vacation Setting
Vacation function: It’s used to keep the indoor ambient temperature and activate fast heating.
Under heating mode, press “Function” button to select Vacation function with “Vacation” icon
ÀDVKLQJ3UHVV³(QWHU&DQFHO´EXWWRQWRDFWLYDWH9DFDWLRQIXQFWLRQ
When Vacation is on, press “Function” button to set function. Then press the “Enter/Cancel”
EXWWRQWRFDQFHO9DFDWLRQIXQFWLRQZLWKQRLFRQÀDVKLQJ
How to set vacation function is shown in the Fig.18:

Wired Controller XK60
15
Unit On, no Vacation function Press “Function” button to set
vacation function
Press “Enter/Cancel” button to
activate vacation function
Press “Function” button to set
vacation function
Press “Enter/Cancel” button to
cancel vacation function
Fig.18 Vacation Setting
Note:
ķ
The vacation function can be only set under heating mode.
ĸ
The turbo function will be cancelled when the vacation function is set.
Ĺ
The Sleep and Quiet function will be cancelled when the vacation function is set.
ĺ
After the unit is resumed, the vacation function will be maintained.
Ļ
When the vacation function is set, the setting temperature can not be shielded by the
remote control. In reverse, the vacation function can not be set when the distant shielding
is taking into effect.
ļ
When the vacation function is set, the setting temperature shown on the wired controller is
8°C. The indoor fan will automatically run as perAuto fan speed.
Ľ
The vacation function can be cancelled when there is mode switching. The temperature will
go back to the original setting temperature prior to vacation function.
ľ
Unit ON/OFF will not cancel the vacation function.
3.13 Turbo Function Setting
TURBO function: The unit at the highest fan speed can realize quick cooling or heating so that
room temperature can quickly approach the setting temperature.
In the COOL or HEAT mode, press the Function button to select the "Turbo" function option and
then press the Enter/Cancel button to activate it.
:KHQWKH7XUERIXQFWLRQLVDFWLYDWHGLWFDQEHGHDFWLYDWHGE\¿UVWO\SUHVVLQJWKH)XQFWLRQ

Wired Controller XK60
16
button to select the "Turbo" option and then pressing the Enter/Cancel button.
Turbo function setting is as shown in Fig.19:
Unit On, no Turbo function Press “Function” button to set
turbo function
Press “Enter/Cancel” button to
activate turbo function
Press “Function” button to set
turbo function
Press “Enter/Cancel” button to
cancel turbo function
Fig.19 Turbo Function Setting
Notes:
ķ
The Turbo function will be deactivated due to power failure. In DRY, FAN and AUTO modes,
the Turbo function is unavailable and the function symbol won’t be displayed.
ĸ
The Turbo function will be automatically deactivated as the Quiet function is activated.
Ĺ
The FAN button can also be used to adjust Turbo function.
3.14 SAVE Function Setting
Energy Saving Function: Energy saving can make the air conditioner runs in a smaller
temperature range by setting lower limited value of setting temperature in the COOL or DRY mode
and upper limited value in the HEAT mode.
(1). Energy Saving Setting for Cooling
When the unit runs under the COOL or DRY mode, press the Function button to select the
³6$9(´IXQFWLRQRSWLRQZLWK³6$9(´ÀDVKLQJDQGWKHQSUHVVŸRUźWRDGMXVWWKHORZHUOLPLWDIWHU
that, press the Enter/Cancel button to activate this function.
(2). Energy Saving Setting for Heating
When the unit runs under the HEAT mode, press the Function button to select the “SAVE”
IXQFWLRQRSWLRQZLWK³6$9,1*´ÀDVKLQJWKHQSUHVVWKH0RGHEXWWRQWRVZLWFKWRWKH³6$9(´VHWWLQJ
IRUWKH+($7PRGHDQGWKHQSUHVVŸRUźWRDGMXVWWKHXSSHUOLPLWDIWHUWKDWSUHVVWKH(QWHU
Table of contents
Other INVENTOR Controllers manuals