GE JB735 User manual

Write the model and serial
numbers here:
Model #_________________
Serial # _________________
You can find them on a label
behind the door or drawer.
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
OWNER’S MANUAL
RANGES
Electric Free-Standing
49-2000999 Rev. 1 11-21 GEA
30" Free-Standing Range
PB935, JB735, JS760
GE is a trademark of the General Electric Company. Manufactured under trademark license.
SAFETY INFORMATION .......... 3
USING THE RANGE
Surface Units........................... 7
Cookware for Radiant Glass Cooktop. . . . . . 9
WiFi Connect ..........................10
Oven Controls..........................11
Special Features ........................12
Sabbath Mode..........................13
Oven Racks ............................14
Aluminum Foil and Oven Liners...........14
Oven Cookware ........................14
Cooking Modes.........................15
Cooking Guide .........................16
Air Fry Cooking Guide...................17
CARE AND CLEANING
Cleaning the Range – Exterior ............18
Cleaning the Range – Interior ............19
Cleaning the Glass Cooktop ..............21
Oven Light............................ 23
Oven Door ............................24
Storage Drawer. . . . . . . . . . . . . . . . . . . . . . . . 24
Removable Storage Drawer ............. 25
TROUBLESHOOTING TIPS.......26
LIMITED WARRANTY ............30
ACCESSORIES .....................31
CONSUMER SUPPORT ........... 32

249-2000999 Rev. 1
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.

49-2000999 Rev. 13
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
ANTI-TIP DEVICE
To reduce the risk of tipping the range,
the range must be secured by a properly
installed anti-tip bracket. See installation
instructions shipped with the bracket for
complete details before attempting to install.
For Free-Standing and Slide-In Ranges
To check if the bracket is installed and
engaged properly, look underneath the
range to see that the rear leveling leg is
engaged in the bracket. On some models, the storage drawer or kick panel
can be removed for easy inspection. If visual inspection is not possible,
slide the range forward, confirm the anti-tip bracket is securely attached to
the floor or wall, and slide the range back so the rear leveling leg is under
the anti-tip bracket.
If the range is pulled from the wall for any reason, always repeat this
procedure to verify the range is properly secured by the anti-tip bracket.
Never completely remove the leveling legs or the range will not be secured
to the anti-tip device properly.
WARNING Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
• A child or adult can tip the range and be killed.
• Install the anti-tip bracket to the wall or floor.
•
Engage the range to the anti-tip bracket by sliding the
range back such that the foot is engaged.
• Re-engage the anti-tip bracket if the range is moved.
• Failure to do so can result in death or serious burns
to children or adults.
Tip-Over Hazard
WARNING
Anti-Tip
Bracket
Leveling Leg
Free-Standing and Slide-In Ranges
WARNING GENERAL SAFETY INSTRUCTIONS
■ Usethisapplianceonlyforitsintendedpurposeas
described in this Owner’s Manual.
■ Besureyourapplianceisproperlyinstalledand
grounded by a qualified installer in accordance with
the provided installation instructions.
■ Donotattempttorepairorreplaceanypartofyour
range unless it is specifically recommended in this
manual. All other servicing should be transferred to
a qualified technician.
■ Beforeperforminganyservice,unplugtherange
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
■ Donotleavechildrenalone—childrenshouldnot
be left alone or unattended in an area where an
appliance is in use. They should never be allowed
to climb, sit or stand on any part of the appliance.
■ CAUTION Donotstoreitemsofinterestto
children above a range or on the backguard of a
range—childrenclimbingontherangetoreach
items could be seriously injured.

449-2000999 Rev. 1
WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
Failure to do so may result in fire or personal injury.
■ Donotstoreoruseflammablematerialsinanoven
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
■ Neverwearloose-fittingorhanginggarmentswhile
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
■ Donotletcookinggreaseorotherflammable
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
■ Cleanventilatinghoodsfrequently.Greaseshould
not be allowed to accumulate on the hood or filter.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
■ Donotusewaterongreasefires.Neverpickup
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
tray.Useamulti-purposedrychemicalorfoam-type
fire extinguisher.
■ Ifthereisafireintheovenduringbaking,smother
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
■ Ifthereisafireintheovenduringself-clean,turn
the oven off and wait for the fire to go out. Donot
force the door open. Introduction of fresh air at self-
clean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING GENERAL SAFETY INSTRUCTIONS (Cont.)
■ Useonlydrypotholders—moistordamppot
holders on hot surfaces may result in burns from
steam.Donotletpotholderstouchhotsurface
unitsorheatingelements.Donotuseatowelor
other bulky cloth in place of pot holders.
■ Neveruseyourapplianceforwarmingorheating
the room.
■ Donottouchthesurfaceunits,theheatingelements
or the interior surface of the oven. These surfaces
may be hot enough to burn even though they are
darkincolor.Duringandafteruse,donottouch,
or let clothing or other flammable materials contact
the surface units, areas nearby the surface units or
any interior area of the oven; allow sufficient time
for cooling first. Other surfaces of the appliance
may become hot enough to cause burns. Potentially
hot surfaces include the cooktop, areas facing the
cooktop, oven vent opening, surfaces near the
opening and crevices around the oven door.
■ Donotheatunopenedfoodcontainers.Pressure
could build up and the container could burst,
causing an injury.
■ Donotuseanytypeoffoilorlinertocoverthe
oven bottom or anywhere in the oven, except as
described in this manual. Oven liners can trap heat
or melt, resulting in damage to the product and risk
of shock, smoke or fire.
■ Avoidscratchingorimpactingglassdoors,cook
topsorcontrolpanels.Doingsomayleadtoglass
breakage.Donotcookonaproductwithbroken
glass. Shock, fire or cuts may occur.
■ Cookmeatandpoultrythoroughly—meattoatleast
an internal temperature of 160°F and poultry to at
least an internal temperature of 180°F. Cooking
to these temperatures usually protects against
foodborne illness.

49-2000999 Rev. 15
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING COOKTOP SAFETY INSTRUCTIONS
■ Neverleavethesurfaceunitsunattended.Boilovers
cause smoking and greasy spillovers that may catch
on fire.
■ Neverleaveoilunattendedwhilefrying.Ifallowed
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
cabinets.Useadeepfatthermometerwhenever
possible to monitor oil temperature.
■ Toavoidoilspilloverandfire,useaminimum
amount of oil when shallow pan-frying and avoid
cooking frozen foods with excessive amounts of ice.
■ Useproperpansize—selectcookwarehaving
flat bottoms large enough to cover the surface
heating element. The use of undersized cookware
will expose a portion of the surface unit to direct
contact and may result in ignition of clothing. Proper
relationship of cookware to surface unit will also
improve efficiency.
■ Onlycertaintypesofglass,glass/ceramic,
earthenware or other glazed containers are suitable
for cooktop service; others may break because of
the sudden change in temperature.
■ Tominimizethepossibilityofburns,ignitionof
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby surface units.
■ Whenpreparingflamingfoodsunderahood,turn
the fan on.
■ Ifpowerislosttoanelectriccooktopwhileasurface
unit is ON, the surface unit will turn back on as
soon as power is restored. In the event of power
loss, failure to turn all surface unit knobs to the OFF
position may result in ignition of items on or near the
cooktop, leading to serious injury or death.
WARNING RADIANT COOKTOP SAFETY INSTRUCTIONS
■ Usecarewhentouchingthecooktop.Theglass
surface of the cooktop will retain heat after the
controls have been turned off.
■ Donotcookonabrokencooktop.Ifglasscooktop
should break, cleaning solutions and spillovers
may penetrate the broken cooktop and create a
risk of electric shock. Contact a qualified technician
immediately.
■ Avoidscratchingtheglasscooktop.Thecooktop
can be scratched with items such as knives, sharp
instruments, rings or other jewelry, and rivets on
clothing.
■ Donotplaceorstoreitemsthatcanmeltorcatch
fire on the glass cooktop, even when it is not being
used. If the cooktop is inadvertently turned on, they
may ignite. Heat from the cooktop or oven vent after
it is turned off may cause them to ignite also.
■ Useceramiccooktopcleanerandnon-scratch
cleaning pad to clean the cooktop. Wait until the
cooktop cools and the indicator light goes out
before cleaning. a wet sponge or cloth on a hot
surface can cause steam burns. Some cleaners can
produce noxious fumes if applied to a hot surface.
NOTE: Sugar spills are an exception. They should
be scraped off while still hot using an oven mitt
and a scraper. See the Cleaning the glass cooktop
section for detailed instructions.
■ Readandfollowallinstructionsandwarningsonthe
cleaning cream label.

649-2000999 Rev. 1
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface.Donotuseanysharpitemstoremovethefilm.
Remove all of the film before using the appliance for the
first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
Consider recycling options for your appliance packaging
material.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING SELF-CLEANING OVEN SAFETY INSTRUCTIONS
The self-cleaning feature operates the oven at temperatures high enough to burn away food soils in the oven.
Follow these instructions for safe operation.
■ Donottouchovensurfacesduringself-clean
operation. Keep children away from the oven during
self-cleaning. Failure to follow these instructions
may cause burns.
■ Beforeoperatingtheself-cleancycle,removepans,
shiny metal oven racks and other utensils from the
oven. Only gray porcelain-coated oven racks may
beleftintheoven.Donotuseself-cleantoclean
other parts, such as drip pans or bowls.
■ Beforeoperatingtheself-cleancycle,wipegrease
and food soils from the oven. Excessive amount of
grease may ignite leading to smoke damage to your
home.
■ Iftheself-cleaningmodemalfunctions,turnthe
oven off and disconnect the power supply. Have it
serviced by a qualified technician.
■ Donotcleanthedoorgasket.Thedoorgasketis
essential for a good seal. Care should be taken not
to rub, damage or move the gasket.
■ Donotuseaprotectivecoatingtolinetheoven
and do not use commercial oven cleaners unless
certified for use in a self-cleaning oven.
WARNING OVEN SAFETY INSTRUCTIONS
■ Standawayfromtherangewhenopeningtheoven
door. Hot air or steam which escapes can cause
burnstohands,faceand/oreyes.
■ Donotusetheovenifaheatingelementdevelops
a glowing spot during use or shows other signs
of damage. A glowing spot indicates the heating
element may fail and present a potential burn, fire,
or shock hazard. Turn the oven off immediately and
have the heating element replaced by a qualified
service technician.
■ Keeptheovenventunobstructed.
■ Keeptheovenfreefromgreasebuildup.Greasein
the oven may ignite.
■ Placeovenracksindesiredlocationwhileovenis
cool. If rack must be moved while oven is hot, do not
let pot holder contact hot heating element in oven.
■ Whenusingcookingorroastingbagsintheoven,
follow the manufacturer’s directions.
■ Pulltheovenracktothestop-lockpositionwhen
loading and unloading food from the oven. This
helps prevent burns from touching hot surfaces of
the door and oven walls.
■ Donotleaveitemssuchaspaper,cookingutensils
or food in the oven when not in use. Items stored in
an oven can ignite.
■ Neverplacecookingutensils,pizzaorbakingstones,
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.
PROPER DISPOSAL OF YOUR APPLIANCE
DisposeoforrecycleyourapplianceinaccordancewithFederalandLocalRegulations.Contactyourlocal
authorities for the environmentally safe disposal or recycling of your appliance.

49-2000999 Rev. 17
Throughout this manual, features and appearance may vary from your model.
How to Set
Push the knob in and turn in either direction to the
setting you want.
A surface ON indicator light will glow when any surface
unit is on
For glass cooktop surfaces:
A HOT COOKTOP indicator light will:
■ comeonwhentheunitishottothetouch.
■ stayonevenaftertheunitisturnedoff.
■ stayonuntiltheunitiscooledto
approximately 150°F.
Knob appearance may vary
WARNING FIRE HAZARD: Never leave the range ON unattended. Keep flammable items away from the
cooktop. Turn off all controls when done cooking. Failure to follow these instructions can result in
fire, serious injury or death.
Surface Units
Dual and Triple Surface Units and Control Knobs (on some models)
The surface unit has 2 or 3 cooking sizes to select from so you can match the size of the unit to the size of the
cookware you are using.
At both OFF and HI the control clicks into
position. You may hear slight clicking
sounds during cooking, indicating the
control is maintaining your desired setting.
Be sure you turn the control knob to OFF
when you finish cooking.
ModelswithaDual-Ring
surface element only
Models with a Tri-Ring surface
element only.
Melt setting (on some models)
will melt chocolate or butter.
Knob appearance
may vary.
Using the Warming Zone (on some models)
WARNING FOOD POISON HAZARD: Bacteria may grow in food at temperatures below 140°F.
■ Alwaysstartwithhotfood.Donotusewarmsettingtoheatcoldfood.
■ Donotusewarmsettingformorethan2hours.
The Warming Zone, located in the back center of the
glass surface, will keep hot, cooked food at serving
temperature.Alwaysstartwithhotfood.Donotuseto
heat cold food. Placing uncooked or cold food on the
Warming Zone could result in foodborne illness.
Turn the control knob to the ON position or press the
Warming Zone button.
For best results, all foods on the Warming Zone should
be covered with a lid or aluminum foil. When warming
pastries or breads, the cover should be vented to allow
moisture to escape.
The initial temperature, type and amount of food, type of
pan, and the time held will affect the quality of the food.
Always use pot holders or oven mitts
when removing food from the Warming
Zone, since cookware and plates will be
hot.
NOTE: The surface warmer will not
glow red like the cooking elements.
Knob appearance may vary.
USING THE RANGE:SurfaceUnits

849-2000999 Rev. 1
Home Canning Tips
Be sure the canner is centered over the surface unit.
Make sure the canner is flat on the bottom.
To prevent burns from steam or heat, use caution when
canning.
Userecipesandproceduresfromreputablesources.
These are available from manufacturers such as Ball®
and Kerr®andtheDepartmentofAgricultureExtension
Service.
Flat-bottomedcannersarerecommended.Useofwater
bath canners with rippled bottoms may extend the time
required to bring the water to a boil.
Temperature Limiter on Radiant Glass Cooktops
Every radiant surface unit has a temperature limiter.
The temperature limiter protects the glass cooktop from
getting too hot.
The temperature limiter may cycle the surface units off
for a time if:
■ thepanboilsdry.
■ thepanbottomisnotflat.
■ thepanisoff-center.
■ thereisnopanontheunit.
For Models With a Radiant Glass Cooktop
The radiant cooktop features heating units beneath a
smooth glass surface.
NOTE: A slight odor is normal when a new cooktop is
used for the first time. It is caused by the heating of new
parts and insulating materials and will disappear in a
short time.
NOTE: On models with light-colored glass cooktops, it is
normal for the cooking zones to change color when hot
or cooling down. This is temporary and will disappear as
the glass cools to room temperature.
The surface unit will cycle on and off to maintain your
selected control setting.
It is safe to place hot cookware on the glass surface
even when the cooktop is cool.
Even after the surface units are turned off, the glass
cooktop retains enough heat to continue cooking. To
avoid overcooking, remove pans from the surface units
when the food is cooked. Avoid placing anything on the
surface unit until it has cooled completely.
■ Waterstains(mineraldeposits)areremovableusing
the cleaning cream or full-strength white vinegar.
■ Useofwindowcleanermayleaveaniridescentfilmon
the cooktop. The cleaning cream will remove this film.
■ Don’tstoreheavyitemsabovethecooktop.Ifthey
drop onto the cooktop, they can cause damage.
■ Donotusethesurfaceasacuttingboard.
Surface Units
Never cook directly on the glass.
Always use cookware.
Always place the pan in the center of the
surface unit you are cooking on.
Donotslidecookwareacrossthecooktopbecause
itcanscratchtheglass—theglassisscratch-
resistant, not scratch proof.
USING THE RANGE:SurfaceUnits

49-2000999 Rev. 19
USING THE RANGE: Cookware for Radiant Glass Cooktop
Cookware for Radiant Glass Cooktop
The following information will help you choose cookware which will give good performance on glass cooktops.
NOTE: Follow all cookware manufacturer’s recommendations when using any type of cookware on the ceramic cooktop.
Recommended
Stainless Steel
Aluminum:
heavy weight recommended
Good conductivity. Aluminum residues
sometimes appear as scratches on the
cooktop but can be removed if cleaned
immediately. Because of its low melting
point, thin weight aluminum should not
be used.
Copper Bottom:
Copper may leave residues which can
appear as scratches. The residues can
be removed, as long as the cooktop
is cleaned immediately. However, do
not let these pots boil dry. Overheated
metal can bond to glass cooktops. An
overheated copper bottom pot will leave
a residue that will permanently stain the
cooktop if not removed immediately.
Enamel (painted) on Cast Iron:
recommended if bottom of pan is coated
Avoid/Not Recommended
Enamel (painted) on Steel:
Heating empty pans can cause
permanent damage to cooktop glass.
The enamel can melt and bond to the
ceramic cooktop.
Glass-ceramic:
Poor performance. Will scratch the
surface.
Stoneware:
Poor performance. May scratch the
surface.
Cast Iron:
notrecommended—unlessdesigned
specifically for glass cooktops
Poor conductivity and slow to absorb
heat. Will scratch the cooktop surface.
Check pans for flat bottoms by
using a straight edge.
Pans with rounded, curved,
ridged or warped bottoms are
not recommended.
For Best Results
■ Placeonlydrypansonthesurfaceelements.Donot
place lids on the surface elements, particularly wet lids.
Wet pans and lids may stick to the surface when cool.
■ Donotusewoksthathavesupportrings.Thistypeof
wok will not heat on glass surface elements.
■ Werecommendthatyouuseonlyaflat-bottomed
wok. They are available at your local retail store. The
bottom of the wok should have the same diameter as
the surface element to ensure proper contact.
■ Somespecialcookingproceduresrequirespecific
cookware such as pressure cookers or deep-fat
fryers. All cookware must have flat bottoms and be
the correct size.
Donotplacewetpansontheglasscooktop.
Donotusewokswithsupportringsontheglasscooktop.
Useflat-bottomedwoksontheglasscooktop.

10 49-2000999 Rev. 1
WiFi Connect (on some models)
USING THE RANGE: WiFi Connect
Your oven is designed to provide you with two-way
communication between your appliance and smart
device. By using the WiFi Connect features, you will
be able to control essential oven operations such as
temperature settings, timers and cooking modes using
your smartphone or tablet.*
Press and hold WiFi Connect pad for 3 seconds - follow
the instructions on your oven display and phone app. It is
necessary to turn on WiFi before using SmartHQ App on
your oven.
Connecting your WiFi Connect Enabled Oven
What you will need
Your GE Appliances oven uses your existing home WiFi
network to communicate between the appliance and
your smart device. In order to setup your GE Appliances
oven, you will need to gather some information:
1. Each GE Appliances oven has a connected appliance
information label that includes an Appliance Network
Name and Password. These are the two important
details that you will need to connect to the appliance.
The label is typically located inside the door of the
oven or drawer.
2. Have your smart phone or tablet ready with the ability
to access the internet and download apps.
3. You will need to know the password of your home
WiFi router. Have this password ready while you are
setting up your GE Appliances oven.
Connect your GE Appliances oven
1. On your smart phone or tablet visit
GEAppliances.com/connect to learn more about
connected appliance features and to download the
SmrtHQ App.
2. Follow the app onscreen instructions to connect your
GE Appliances oven.
3. Once the process is complete, the connection light
located on your GE Appliances oven display will stay
on solid and the app will confirm you are connected.
4. If the connection light does not turn on or is blinking,
follow the instructions on the app to reconnect. If
issues continue, please call the Connected Call
Center 1.800.220.6899 and ask for assistance
regarding oven wireless connectivity.
To connect additional smart devices, repeat steps 1 and 2.
Note that any changes or modifications to the remote
enable device installed on this oven that are not
expressly approved by the manufacturer could void the
user’s authority to operate the equipment.
REMOTE STARTING YOUR OVEN
To be able to start the oven remotely once connected to
WiFi, make sure the icon is visible in the display. The
oven can now be remotely started with a connected device.
The icon must be lit to start the oven remotely. The
icon is not required to change the oven temperature while
it is running, set a timer or to turn the oven off from the
phone app while the icon shows it is Wifi Connected.
If you do not see the icon, refer to the Remote Enable
instructions in the Special Features section of this
manual.
NOTE: Foodsthatspoileasily—suchasmilk,eggs,fish,
stuffings,poultryandpork—shouldnotbeallowedto
sit for more than 1 hour before or after cooking. Room
temperature promotes the growth of harmful bacteria. Be
sure that the oven light is off because heat from the bulb
will speed harmful bacteria growth.
* Compatible Apple or Android devices and home WiFi network required.
FCC: ZKJ-WCATA001 Network: GE_XXXXXX_XXXX
Password: XXXXXXXX
PT. NO. 229C6272G001-0
IC: 10229A-WCATA001
MAC ID: XX - XX - XX - XX - XX - XX
Connected Appliance Information
Sample Label

49-2000999 Rev. 111
USING THE RANGE: Oven Controls
Oven Controls
1. Convection Cooking Modes: Convection
cooking modes use increased air circulation to improve
performance. The type of benefit depends on the
mode. Your oven has the following convection cooking
modes: Convection Bake and Convection Roast. See
the Cooking Modes section for more information.
2. Traditional Cooking Modes: Your oven has
the following traditional cooking modes: Bake, Broil
Hi/Lo, and Warm. See the Cooking Modes section for
more information.
3. Clean: Your oven has two cleaning modes: Self
Clean and Steam Clean. See the Cleaning the Oven
section for important information about using these
modes.
4. Start: Must be pressed to start any cooking,
cleaning, or timed function.
5. Cancel/Off: Cancels ALL oven operations except
theclock,timer,WarmingDrawerandWarmingZone.
6. Cook Time: Counts down cooking time and turns
off the oven when the cooking time is complete. Press
the Cook Time pad, use the number pads to program
a cooking time in hours and minutes, then press Start.
This can only be used with Bake, Convection Bake,
Convection Roast, Warm, and Air Fry.
You may use Cook Time at any point during the oven
cooking cycle
7. Clock: Press and hold the 0pad for 3 seconds to set
clock.
8. Timer On/Off: Works as a countdown timer.
Press the Timer On/Off pad and the number pads
to program the time in hours and minutes. Press the
Start pad. The timer countdown is complete. To turn
the timer off press the Timer On/Off pad.
9.
Delay Time: Delayswhentheovenwillturnon.Use
this to set a time when you want the oven to start. Press
the desired cooking mode and temperature. A Cook Time
may also be programmed if desired. Follow the directions
under Cook Time for setting this feature. Press the Delay
Time pad and use the number pads to program the time
of day for the oven to turn on then press Start. This can
only be used with Bake, Convection Bake, Convection
Roast, and Self-Clean.
NOTE: WhenusingtheDelayTimefeature, foods that
spoileasily—suchasmilk,eggs,fish,stuffings,poultry
andpork—shouldnotbeallowedtositformorethan
1 hour before or after cooking. Room temperature
promotes the growth of harmful bacteria. Be sure that
the oven light is off because heat from the bulb will
speed harmful bacteria growth.
10. Oven Light: Turns the oven light on or off.
11. Lock Controls: Locks out the control so that
pressing the pads does not activate the controls. Press
the Lock Controls pad, for three seconds to lock or
unlock the control. Cancel/Off is always active, even
when the control is locked.
12. WiFi Connect (on some models): For
instructions on how to connect your oven, see the WiFi
Connect section of this manual.
13. Air Fry: The Air Fry mode is designed to produce
foods with a crispier exterior than traditional oven
cooking. See the Oven Cooking Modes section for
more information.
14. Warming Zone (on some
models): TheWarmingZonewill
keep hot, cooked food at serving
temperature.SeetheWarmingZone
section for more information.
1
10
9
2
13
3 4 5
12 7 8
11 6

12 49-2000999 Rev. 1
USING THE RANGE: Special Features
Special Features
There are several different special features on your range. To change the settings of these special features:
■ PresstheBake and Broil pads at the same time and hold until the special features menu is displayed.
■ Usethe2or 8number pads to scroll through the special features until the desired feature is displayed.
■ Pressthe6number pad to enter into the feature’s menu and scroll through the options.
■ Oncethedesiredoptionisdisplayed,pressthe6pad to save the setting and the 4pad to exit the menu.
Adjust the Oven Temperature (OFSt)
This feature allows the oven baking temperature to be
adjustedupto35ºFhotterordownto35ºFcooler.Use
this feature if you believe your oven temperature is too
hot or too cold and wish to change it. This adjustment
affects every cooking mode except broil.
Enter into the special features menu as outlined above.
Scroll through the features until “OFSt” is displayed
and press 6.Usethe2pad to increase the adjusted
temperature or use the 8pad to decrease the adjusted
temperature. Save and exit the special features menu.
End of Timer Signals (End tonE)
This is the tone that signals the end of a timer. The
tone can be either continuous (Cont) or single (bEEp).
The continuous setting (Cont) will repeatedly sound a
tone every few seconds until a button on the control
is pressed. A single setting (bEEp) will sound just a
single tone at the end of the timer. Enter into the special
features menu as outlined above. Scroll through the
options until “End tonE” is displayed and press 6. Scroll
through the options until the desired setting is displayed.
Press 6to save the setting and then 4to exit the menu.
Fahrenheit or Celsius Temperature
Display (Unit dEg)
The oven control is set to use Fahrenheit temperatures
(F), but you can change it to use Celsius temperatures
(C). Enter into the special features menu as outlined
above.Scrollthroughtheoptionsuntil“degUnit”is
displayed and press 6. Scroll through the options until
the desired setting is displayed. Press 6to save the
setting and then 4to exit the menu.
Clock Display (CLoc diSP)
Thisfeature(On/Off)specifiesifthetimeofdayis
displayed. Enter into the special features menu as
outlined above. Scroll through the options until “Cloc
diSP” is displayed and press 6. Scroll through the
options until the desired setting is displayed. Press 6to
save the setting and then 4to exit the menu.
Clock Configuration (Cloc cFg)
This feature specifies how the time of day will be
displayed. You can select a standard 12-hour clock (12)
or 24-hour military time display. Enter into the special
features menu as outlined above. Scroll through the
options until “Cloc cFg” is displayed and press 6. Scroll
through the options until the desired setting is displayed.
Press 6to save the setting and then 4to exit the menu.
Sound Volume (Snd)
This feature allows the oven tone volume to be adjusted
on and off (oFF). Enter into the special features menu as
outlined above. Scroll through the options until “sound”
is displayed and press 6. Scroll through the options until
the desired setting is displayed. Press 6to save the
setting and then 4to exit the menu. The selected sound
option will play once 6is pressed.
Auto Recipe Conversion
Thisfeature(On/Off),automaticallyadjuststhe
programmed recipe temperature in Convection Multi-
Bake mode. Enter into the special features menu as
outlined above. Scroll through the options until “Auto
rEciPE” is displayed. Scroll through the options until the
desired setting is displayed. Press 6to save the setting
and then 4to exit the menu.
NOTE: This option does not convert baking time, only
temperatures. This option does not adjust temperatures
for Convection Roast mode.
Remote Enable (App ENbl) (on some
models)
Allowsyoutocontrolyourovenremotely(On/Off).Enter
the special features menu as outlined above. Scroll
throughtheoptionsuntil"AppENbl"isdisplayed.Use6
to enter the menu and toggle the setting using the 2 or
8 key. Press the 6 key to save the setting and then 4 to
exit the menu.
12-Hour Auto Shut Off (12H Shut)
This feature turns off the oven after 12 hours of
continuousoperation(On/Off).Enterthespecialfeatures
menu as outlined above. Scroll through the options until
"12HShut"isdisplayed.Use6toenterthemenuand
toggle the setting using the 2 or 8 key. Press the 6 key
to save the setting and then 4 to exit the menu.
4=Cancel/Back,2=Up,8=Down,6=Save/Forward

49-2000999 Rev. 113
Sabbath Mode
The Sabbath mode feature complies with standards set forth by Star K. Some of these standards that will be noticed
by the consumer include the disabling of tones, disabling of oven lights, and delays of about 30 seconds to one
minute on display changes. Only continuous baking or timed baking is allowed in the Sabbath mode. Cooking in the
Sabbath mode is a two-step process, first the Sabbath mode must be set and then the bake mode must be set.
Setting the Sabbath Mode
1. Press and hold Bake + Broil to enter special features
menu.
2. Usenumberkey8tonavigateto“Sabb”menu,Enter
the menu using number key 6.
3. Usenumberkey8againtotogglethesettingtoON.
Usenumberkey6toconfirmthesetting.
4. Usenumberkey4toexitSpecialfeaturesmenu.
Starting a Continuous Bake
1. Press the Bake pad.
2. If the desired temperature is 350F, press Start. If
a different cooking temperature is desired, use the
1through 5number pads or Timer pad to select a
preset cooking temperature, then press Start. Refer
to the graphic below to determine which pad sets the
desired cooking temperature.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking.
Adjusting the Temperature
1. Press Bake, use the 1through 5number pads and
the Timer pad to select a different preset cooking
temperature, and press Start.
2. Since no feedback is given during temperature
change, an oven thermometer can be used to confirm
temperature changes.
Starting a Timed Bake
1. Press the Bake pad.
2. If the desired temperature is 350F, use the 6through
0number pads or the Lock Control pad to select
a cooking time. If a cooking temperature other
than 350F is desired, use the 1through 5number
pads or the Timer pad to select a preset cooking
temperature, then select the cooking time. Refer to
the graphic on this page to determine which pad sets
the desired cooking temperature and cooking time.
3. Press Start.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking. When the cook
time expires, the display will change back to a single
bracket “]” indicating that the oven is no longer baking.
No tone will sound when the cook time is complete.
Exit the Sabbath Mode
Exiting the Sabbath mode should be done after the
Sabbath is over.
1. Press Cancel/Off to end any bake mode that may be
running.
2. Press and hold Bake + Broil to enter special features
menu.
3. Usenumberkey8tonavigateto“Sabb”menu,Enter
the menu using num key 6.
4. Usenumberkey8againtotogglethesettingtoOFF.
Usenumberkey6toconfirmthesetting.
5. Usenumberkey4toexitSpecialfeaturesmenu.
Sabbath Mode Power Outage Note
If a power outage occurs while the oven is in Sabbath
Mode, the unit will return to Sabbath Mode when power
is restored, however the oven will return to the off state
even if it was in the middle of a bake cycle when the
power outage occurred.
USING THE RANGE: Sabbath Mode
1 = 170° F, 2 = 200° F, 3 = 250° F, 4 = 300° F, 5 = 325° F, Timer = 400° F
6 = 2 hours, 7 = 2.5 hours, 8 = 3 hours, 9 = 3.5 hours,
0 = 4 hours, Lock Controls = 6 hours
Temperature (°F) 400
Time (hours) 6h
170
2h
200
2.5h
250
3h
300
3.5h
325
4h

14 49-2000999 Rev. 1
The number of rack positions may vary by model.
USING THE RANGE:OvenRacks/AluminumFoil/OvenCookware
Oven Racks
Recommended rack positions for various types of
foods are provided in the Cooking Guide. Adjusting
rack position is one way to impact cooking results. For
example, if you would prefer darker tops on cakes,
muffins, or cookies, try moving food one rack position
higher. If you find foods are too brown on top try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is at least 1½" between pans to allow
sufficient space for air to flow.
YourOvenmayhaveextensionracksand/ortraditional
flat racks.
To avoid possible burns, place the racks in the desired
position before you turn the oven on.
Oven Cookware
Cookware Guidelines
The material, finish, and size of cookware affect baking
performance.
Dark,coatedanddullpansabsorbheatmorereadily
than light, shiny pans. Pans that absorb heat more
readily can result in a browner, crisper, and thicker crust.
If using dark and coated cookware check food earlier
than minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
oven temperature by 25º F next time.
Shiny pans can produce more evenly cooked baked
goods such as cakes and cookies.
Glass and ceramic pans heat slowly but retain heat well.
These types of pans work well for dishes such as pies
and custards.
Air insulated pans heat slowly and can reduce bottom
browning.
Keep cookware clean to promote even heating.
Stoneware heats slowly and retains heat well. It is
recommended to preheat this type of cookware if
possible. Additional cook time may be required.
Cookware used in broil modes and air fry must be broil-
safe.
CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foilmaybeusedtocatchspillsbyplacingasheetonalowerrack,severalinchesbelowthefood.Donotusemore
foilthannecessaryandneverentirelycoveranovenrackwithaluminumfoil.Keepfoilatleast1-1/2”fromovenwalls
to prevent poor heat circulation.
Aluminum Foil and Oven Liners

49-2000999 Rev. 115
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Cooking Guide section for rack position and other recommendations for specific modes and foods.
Remember, your new oven may perform differently than the oven it is replacing.
Baking and Roasting Modes
Select a mode for baking and roasting based on the
type and quantity of food you are preparing. When
preparing baked goods such as cakes, cookies, and
pastries always preheat the oven first. Follow recipe
recommendations for food placement. If no guidelines
are provided, center food in the oven.
Traditional Bake
The Bake mode is for baking and roasting. When
preparing baked goods such as cakes, cookies, and
pastries, always preheat the oven first. To use this mode
press the Bake pad, enter a temperature, and then press
Start.
Convection Bake
This mode uses air movement from the convection fan
to enhance cooking evenness. Your oven is equipped
with Auto Recipe Conversion, so it is not necessary to
adjust the temperature when using this mode. Always
preheat when using this mode. Baking time might be
slightly longer for multiple racks than what would be
expected for a single rack. To use this mode press the
Convection Bake pad, enter a temperature, and then
press Start.
Convection Roast
The Convection Roast mode is intended for roasting
whole cuts of meat on a single rack. This mode uses air
movement from the convection fan to improve browning
and reduce cooking time. Check food earlier than the
recipe suggested time when using this mode. To use
this mode press the Convection Roast pad, enter a
temperature, and then press Start.
Air Fry
Air Fry is a special, no-preheat, cooking mode that is
designed to produce foods with a crispier exterior than
traditional oven cooking. The Air Fry mode is intended
for single rack cooking only. Select Air Fry, then input
the desired set temperature and press Start. The
temperature can be set between 300°F and 500°F.
Preheating is not recommended for this mode. Follow
traditional oven recipe or package guidelines for set
temperatures and cook times; adjust cook time to
achieve your desired crispness. Additional guidelines for
using this mode can be found in the Cooking Guide.
Broiling Modes
Always broil with the oven door closed. Monitor food
closelywhilebroiling.Usecautionwhenbroiling;placing
food closer to the broil element increases smoking,
spattering, and the possibility of fats igniting. It is not
necessary to preheat when using the Broil modes.
Broil Hi
The Broil Hi mode uses intense heat from the upper
elementtosearfoods.UseBroilHiforthinnercuts
ofmeatand/orwhenyouwouldliketohaveaseared
surface and rare interior. To use this mode press the
Broil pad once and then press Start.
Broil Lo
The Broil Lo mode uses less intense heat from the upper
element to cook food thoroughly while also browning
thesurface.UseBroilLoforthickercutsofmeatand/or
foods that you would like cooked all the way through. To
use this mode press the Broil pad twice and then press
Start.
Warm
Warm modes are designed to keep hot, cooked foods
hot. Cover foods that should remain moist and do
not cover foods that should be crisp. Preheating is
notrequired.Donotusewarmtoheatcoldfood.Itis
recommended that food not be kept warm for more than
2 hours. To use this mode, press the Warm pad then
press Start. The control display will show the oven is set
to Bake at 170F.
Pre-Heat
Proper preheating ensures that the oven is hot enough
to begin baking. Improper preheating (that is, cooking
in the oven that has not come up to set temperature)
cannegativelyaffectcooking.Dependingontherecipe
recommendations, the temperature of your foods when
they go into the oven may determine your final baking
time and baking results; if you put your food, such as
biscuits or breads, in during Pre-heat, they may over
brown on top or burn.
IMPORTANT: The more items to be heated in the oven
during preheat (this includes multiple racks, baking
stones, etc.) will affect the length of your pre-heat time.
Always begin baking after the pre-heat signal. The signal
will be a beep, indicaotr light or chime. This lets you
know your oven is at your needed baking temperature.
For best results, turn the oven On before you begin your
prep work.
Cooking Modes
USING THE OVEN: Cooking Modes

16 49-2000999 Rev. 1
FOOD TYPE
RECOMMENDED
MODE(S)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer Cakes, sheet cakes,
bundt cakes, muffins, quick
breads on a Single Rack
Bake 3 Useshinycookware.
Layer cakes* on Multiple Racks Bake
Convection Bake 2 and 4 Ensure adequate airflow
(see illustration below).
Chiffon cakes (angel food) Bake 1 Useshinycookware.
Cookies, biscuits, scones on a
Single Rack Bake 3 Useshinycookware.
Cookies, biscuits, scones on
Multiple Racks Convection Bake 2 and 4
2, 4, and 6 Ensure adequate airflow.
Beef & Pork
Hamburgers Broil Hi 6
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling. For best
performance center food below the broil heating element.
Steaks & Chops Broil Hi 6
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling. For best
performance center food below the broil heating element.
Roasts Bake
Convection Roast 2 or 3 Usealowsidedpansuchasabroilpan.Preheatingis
not necessary.
Poultry
Whole chicken Bake
Convection Roast 2 or 3 Usealowsidedpansuchasabroilpan.
Bone-in chicken breasts, legs,
thighs
Broil Hi 2 If breaded or coated in sauce avoid Broil Hi modes. Broil
skin side down first. Watch food closely when broiling. For
best performance when broiling, center food below the
broil heating element.
Broil Lo
Bake 2 or 3
Boneless chicken breasts Broil Lo
Bake 2 or 3
Movefooddownformoredoneness/lesssearingand
upforgreatersearing/browningwhenbroiling.Forbest
performance when broiling, center food below the broil
heating element
Whole turkey Bake
Convection Roast 1 or 2 Usealowsidedpansuchasabroilpan.
Turkey Breast Bake
Convection Roast 2 or 3 Usealowsidedpansuchasabroilpan.
Fish Broil Lo 6(1/2thickorless)
5(>1/2inch)
Watch food closely when broiling. For best performance
center food below the broil heating element.
Casseroles Bake 3
Frozen Convenience Foods
Single Rack Bake 4
Placefoodinovenpriortostartingmode.Usedark
cookwareformorebrowning/crisping;useshinycookware
for less browning.
Multiple Racks Convection Bake 2 and 4
Usedarkcookwareformorebrowning/crisping;useshiny
cookware for less browning. For multiple racks of pizzas,
stagger left to right, do not place directly over each other.
Oven Cooking Guide
*When baking four cake layers at a time with traditional
bake, use racks 2 and 4.
*When baking four cake layers at a time with convection
bake, use racks 2 and 4.
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov. Make sure to use a food thermometer
to take food temperatures.
CARE AND CLEANING: Oven Cooking Guide

49-2000999 Rev. 117
CARE AND CLEANING: Cooking Guide
Oven Cooking Guide
Air Fry Cooking Guide
Air Fry is a special, no-preheat, cooking mode that
is designed to produce foods with a crispier exterior
than traditional oven cooking. Select Air Fry, then
input the desired set temperature and press Start. The
temperature can be set between 300°F and 500°F.
Air Fry Cookware Guidelines
• Only use broil safe cookware when using Air Fry mode.
• A dark sheet pan is recommended. A dark pan
promotes better browning and crisping.
• Oven baking baskets and baking grids can also be
used. A sheet pan should be placed on the rack below
the foods to catch any drippings when using a baking
basket.
General Tips for Air Fry Mode
• The Air Fry mode is designed for cooking on a single
rack.
• The Air Fry mode is designed to be used without
preheating.
•Rackposition4isrecommendedformostfoods.Use
rack position 3 for thicker foods.
• Foods may cook faster than expected if the oven is
already hot when food is placed in the oven.
• When air frying foods with sauce, it is recommended to
apply the sauce at the end of cooking.
• If foods are browning too quickly, try a lower rack
position or lower oven set temperature.
• For packaged foods, use traditional oven cooking
instructions for set temperature and expected cook
time.
• It is not necessary to flip or stir food during cooking
• Arrange food in a single layer on the pan, do not
overload the pan.
• Always check internal food temperature to confirm
minimum safe temperatures have been reached.
Minimum safe food temperatures can be found on
packages and at IsItDoneYet.gov.
FOOD TYPE
RECOMMENDED
RACK POSITION(S)
RECOMMENDED
SET TEMPERATURES (F°)
RECOMMENDED
COOK TIME (MIN) NOTES
Fresh boneless fish or
poultry pieces, breaded such
as nuggets, tenders, fillets
4 375-400 15-30 Userlowersettemperaturesforlargerpieces.
Useshinycookware.
Fresh bone in
chicken wings 4 375-400 25-40 Salt wings or coat in a dry rub, if using sauce
apply after cooking or toward the end of cooking
Fresh bone in chicken
drumsticks or thighs 3 or 4 375-400 30-55 Userlowersettemperaturesforlargerpieces.
Fresh French fries,
thin (< ½ inch) 4 400-425 15-30
Parchment paper is recommended when
preparing fresh French fries. For crispier fries,
toss fries in corn starch or rice flour before
cooking.
Fresh French fries,
thick (> ½ inch) 3 or 4 375-400 20-35
Parchment paper is recommended when
preparing fresh French fries. For crispier fries,
toss fries in corn starch or rice flour before
cooking.
Frozen packaged
foods
3 or 4
(use rack position 3 for
thicker foods)
Usetraditionaloven(notAirFry)cookinginstructionsasaguidelineforsettemperatureandcooktime.Additional
cook time beyond recommended package time may be required for some foods. If oven is hot when starting, food
may cook faster than the minimum package time.
Primary recommended cookware
Alternate cookware options

18 49-2000999 Rev. 1
A child or adult can tip the range and be killed.
Verify the anti-tip bracket has been properly installed
and engaged.
Ensure the anti-tip bracket is re-engaged when the range
is moved.
Do not operate the range without the anti-tip bracket in
place and engaged.
Failure to follow these instructions can result in death or
serious burns to children or adults.
Tip-Over Hazard
WARNING
Cleaning the Range – Exterior
WARNING If your range is removed for cleaning, servicing or any reason, be sure the
anti-tip device is reengaged properly when the range is replaced. Failure to
take this precaution could result in tipping of the range and can result in death
or serious burns to children or adults.
Be sure all controls are off and all surfaces are cool before cleaning any part of the range.
Control Knobs
The control knobs may be removed for easier cleaning.
Make sure the knobs are in the OFF positions and pull
them straight off the stems for cleaning.
The knobs can be washed with soap and water. Make
sure the inside of the knobs are dry before replacing.
Replace the knobs, in the OFF position to ensure proper
placement.
Control Lockout
If desired, the touch pads may be deactivated before
cleaning.
See Lock Controls in the Oven Controls section in this
manual.
Clean up splatters with a damp cloth.
You may also use a glass cleaner.
Removeheaviersoilwithwarm,soapywater.Donotuse
abrasives of any kind.
Reactivate the touch pads after cleaning.
Control Panel
It’s a good idea to wipe the control panel after each use.
Clean with mild soap and water or vinegar and water,
rinse with clean water and polish dry with a soft cloth.
Donotuseabrasivecleansers,strongliquidcleansers,
plastic scouring pads or oven cleaners on the control
panel—theywilldamagethefinish,includingBlack
Stainless Steel.
Oven Exterior
Donotuseovencleaners,abrasivecleansers,strong
liquid cleansers, steel wool, plastic scouring pads, or
cleaning powders on the exterior of the oven. Clean with
a mild soap and water or vinegar and water solution.
Rinse with clean water and dry with a soft cloth. When
cleaning surfaces, make sure that they are at room
temperature and not in direct sunlight.
If stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up immediately. Let hot surfaces
cool, then clean and rinse.
Painted Surfaces, Black Stainless Steel, and Fingerprint Resistant Stainless Steel
Painted surfaces include the sides of the range and the
door, top of control panel and the drawer front. Clean
these with soap and water or a vinegar and water solution.
Donotusecommercialovencleaners,cleaning
powders, steel wool or harsh abrasives on any painted
surface, including Black Stainless Steel.
Stainless Steel - Excluding Black Stainless Steel
Donotuseasteelwoolpad;itwillscratchthesurface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
Cleaners with oxalic acid such as Bar Keepers Friend Soft
Cleanser™ will remove surface rust, tarnish and small
blemishes.Useonlyaliquidcleanserfreeofgritandrubin
the direction of the brush lines with a damp, soft sponge.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end of
this manual.
Porcelain Enamel Cooktop Frame
The porcelain enamel finish is sturdy but breakable if
misused. This finish is acid-resistant. However, any acidic
foods spilled (such as fruit juices, tomato or vinegar)
should not be permitted to remain on the finish.
If acids spill on the cooktop while it is hot, use a dry paper
towel or cloth to wipe it up right away. When the surface
has cooled, wash with soap and water. Rinse well.
For other spills such as fat spatterings, wash with soap
and water or cleansing powders after the surface has
cooled. Rinse well. Polish with a dry cloth.
CARE AND CLEANING: Cleaning the Range – Exterior

49-2000999 Rev. 119
CARE AND CLEANING: Cleaning the Range – Interior
Cleaning the Range – Interior
The interior of your new oven can be cleaned manually or by using Steam Clean or Self Clean modes.
Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration and
should be wiped up immediately. Let hot surfaces cool, then clean and rinse.
Manual Cleaning
Donotuseovencleaners(unlesscertifiedforself-
cleaning oven), abrasive cleaners, strong liquid
cleansers, steel wool, scouring pads, or cleaning
powders on the interior of the oven. Clean with a mild
soap and water or vinegar and water solution. Rinse with
clean water and dry with a soft cloth. When cleaning
surfaces, make sure that they are at room temperature.
Steam Clean Mode
Steam clean is intended to clean small spills using water
and a lower cleaning temperature than Self-Clean.
To use the Steam Clean feature, wipe grease and soils
from the oven. Pour one cup of water into the bottom of
the oven. Close the door.
Press the Steam Clean pad and then press Start.Do
not open the door during the 30 minute steam clean as
this will decrease the steam clean performance. Wipe
out any excess water and any remaining soil.
Self Clean Mode
Read Self-Cleaning Oven Safety Instructions at the
beginning of this manual before using Self Clean Mode.
Self clean uses very high temperatures to clean the oven
interior. The oven door will lock when using this feature.
Before operating the self-clean cycle, wipe up grease
and soils from the oven. Remove all items from the oven
other than enameled (dark color) racks. Shiny or silver
racks, the meat probe, and any cookware or other items
should all be removed from the oven before initiating a
self-clean cycle. Close the door.
Press the Self Clean pad and a default self-clean time
is displayed. The clean time can be changed to any
time between 3:00 and 5:00 hours by using the number
pads to enter a different time and pressing Start. For
heavily soiled ovens, the maximum 5 hour clean time is
recommended. If you wish to use the default time, press
the Start pad immediately after pressing the Self Clean
pad. The oven will turn off automatically when the self-
clean cycle is complete. The door will stay locked until
the oven has cooled down. After the oven has cooled
down wipe any ash out of the oven.
We recommend venting your kitchen with an open
window or using a ventilation fan or hood during the first
self-clean cycle.
Soil on the front frame of the range and outside the
gasket on the door will need to be cleaned by hand.
Clean these areas with hot water, soap-filled steel-wool
pads or cleansers such as Soft Scrub®. Rinse well with
clean water and dry.
Donotcleanthegasket.Thefiberglassmaterialof
the oven door gasket cannot withstand abrasion. It is
essential for the gasket to remain intact. If you notice it
becoming worn or frayed, replace it.
Make sure the oven light bulb cover is in place and the
oven light is off.
Donotturnonselfcleanwhilecooktopison.SelfClean
will be cancelled within 15 seconds if the cooktop is
turned on.
IMPORTANT: The health of some birds is extremely
sensitive to the fumes given off during the self-cleaning
cycle of any range. Move birds to another well-ventilated
room.

20 49-2000999 Rev. 1
Cleaning the Range – Interior (Cont.)
Racks
All racks can be washed with warm, soapy water.
Enameled (not shiny) racks can be left in the cavity
during self clean.
Racks may be more difficult to slide, especially after
a self-clean. Put some vegetable oil on a soft cloth or
paper towel and rub onto the left and right edges.
Oven Heating Elements
Donotcleanthebroilelement.Anysoilwillburnoff
when the elements are heated.
The bake element is not exposed and is under the oven
floor. Clean the oven floor with warm, soapy water.
Wipe up heavy soil on the oven bottom.
CARE AND CLEANING: Cleaning the Range – Interior
This manual suits for next models
3
Table of contents
Other GE Range manuals

GE
GE JGB450DEKWW User manual

GE
GE RGBS330 User manual

GE
GE Profile P2S975 User manual

GE
GE Profile P2S975DEP User manual

GE
GE Profile Spectra JBP48ABAA User guide

GE
GE Profile PHS925STSS User manual

GE
GE EER3000 User manual

GE
GE -3002 User manual

GE
GE JBP66SMSS - 30" Electric Range Manual

GE
GE Profile JS905TKWW Manual