GE JSS86 User manual

Write the model and serial
numbers here:
Model #_________________
Serial # _________________
You can find them on a label
behind the door or drawer.
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
OWNER’S MANUAL
RANGES
Electric Front Control
49-2000993 Rev. 1 11-21 GEA
30" Front Control Range
JSS86
GE is a trademark of the General Electric Company. Manufactured under trademark license.
SAFETY INFORMATION .......... 3
USING THE RANGE
Surface Units........................... 6
Cookware for Radiant Glass Cooktop. . . . . . 9
Oven Controls..........................10
Cooking Options. . . . . . . . . . . . . . . . . . . . . . . . 11
Settings ...............................12
Sabbath Mode..........................13
Oven Racks ............................14
Aluminum Foil and Oven Liners...........14
Cookware..............................14
Cooking Modes.........................15
Cooking Guide .........................16
Air Fry Cooking Guide...................17
CARE AND CLEANING
Cleaning the Range – Exterior ............18
Cleaning the Range – Interior ............18
Cleaning the Glass Cooktop ..............19
Oven Light.............................21
Oven Doors ........................... 22
TROUBLESHOOTING TIPS....... 23
LIMITED WARRANTY ............26
ACCESSORIES .................... 27
CONSUMER SUPPORT ........... 28

249-2000993 Rev. 1
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.

49-2000993 Rev. 1 3
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
ANTI-TIP DEVICE
To reduce the risk of tipping the range,
the range must be secured by a properly
installed anti-tip bracket. See installation
instructions shipped with the bracket for
complete details before attempting to install.
For Free-Standing and Slide-In Ranges
To check if the bracket is installed and
engaged properly, look underneath the
range to see that the rear leveling leg is
engaged in the bracket. On some models, the storage drawer or kick panel
can be removed for easy inspection. If visual inspection is not possible,
slide the range forward, confirm the anti-tip bracket is securely attached to
the floor or wall, and slide the range back so the rear leveling leg is under
the anti-tip bracket.
If the range is pulled from the wall for any reason, always repeat this
procedure to verify the range is properly secured by the anti-tip bracket.
Never completely remove the leveling legs or the range will not be secured
to the anti-tip device properly.
WARNING Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
• A child or adult can tip the range and be killed.
• Install the anti-tip bracket to the wall or floor.
•
Engage the range to the anti-tip bracket by sliding the
range back such that the foot is engaged.
• Re-engage the anti-tip bracket if the range is moved.
• Failure to do so can result in death or serious burns
to children or adults.
Tip-Over Hazard
WARNING
Anti-Tip
Bracket
Leveling Leg
Free-Standing and Slide-In Ranges
WARNING GENERAL SAFETY INSTRUCTIONS
■ Usethisapplianceonlyforitsintendedpurposeas
described in this Owner’s Manual.
■ Haveyourrangeinstalledandproperlygroundedby
a qualified installer in accordance with the provided
installation instructions.
■ Anyadjustmentandserviceshouldbeperformed
only by a qualified installer or service technician.
Do not attempt to repair or replace any part of your
range unless it is specifically recommended in this
manual.
■ Beforeperforminganyservice,unplugtherange
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
■ Donotleavechildrenalone—childrenshouldnot
be left alone or unattended in an area where an
appliance is in use. They should never be allowed
to climb, sit or stand on any part of the appliance.
■ CAUTION Do not store items of interest to
children above a range or on the backguard of a
range—childrenclimbingontherangetoreach
items could be seriously injured.
■ Useonlydrypotholders—moistordamppot
holders on hot surfaces may result in burns from
steam. Do not let pot holders touch hot surface
units or heating elements. Do not use a towel or
other bulky cloth in place of pot holders.
■ Neveruseyourapplianceforwarmingorheating
the room.
■ Besureallpackingmaterialsareremovedfromthe
range before operating to prevent ignition of these
materials.
■ Donotuseanytypeoffoilorlinertocoverthe
oven bottom or anywhere in the oven, except as
described in this manual. Oven liners can trap heat
or melt, resulting in damage to the product and risk
of shock, smoke or fire.
■ Ifaheatingelement,eitheronasurfaceunitorin
the oven, develops a glowing spot or shows other
signs of damage, do not use that area of the range.
A glowing spot indicates the surface unit may fail
and present a potential burn, fire, or shock hazard.
Turn the heating element off immediately and have
it replaced by a qualified service technician.

449-2000993 Rev. 1
WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
Failure to do so may result in fire or personal injury.
■ Donotstoreoruseflammablematerialsinanoven
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
■ Neverwearloose-fittingorhanginggarmentswhile
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
■ Donotletcookinggreaseorotherflammable
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
■ Cleanventilatinghoodsfrequently.Greaseshould
not be allowed to accumulate on the hood or filter.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
■ Donotusewaterongreasefires.Neverpickup
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
tray.Useamulti-purposedrychemicalorfoam-type
fire extinguisher.
■ Ifthereisafireintheovenduringbaking,smother
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
■ Ifthereisafireintheovenduringself-clean,turn
the oven off and wait for the fire to go out. Do not
force the door open. Introduction of fresh air at self-
clean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING GENERAL SAFETY INSTRUCTIONS (Cont.)
■ Donottouchthesurfaceunits,theheatingelements
or the interior surface of the oven. These surfaces
may be hot enough to burn even though they are
dark in color. During and after use, do not touch,
or let clothing or other flammable materials contact
the surface units, areas nearby the surface units or
any interior area of the oven; allow sufficient time
for cooling first. Other surfaces of the appliance
may become hot enough to cause burns. Potentially
hot surfaces include the cooktop, areas facing the
cooktop, oven vent opening, surfaces near the
opening and crevices around the oven door.
■ Donotheatunopenedfoodcontainers.Pressure
could build up and the container could burst,
causing an injury.
■ Avoidscratchingorimpactingglassdoors,cook
tops or control panels. Doing so may lead to glass
breakage. Do not cook on a product with broken
glass. Shock, fire or cuts may occur. Contact a
qualified technician immediately.
■ Cookfoodthoroughlytohelpprotectagainst
foodborne illness. Minimum safe food temperature
recommendations can be found at IsItDoneYet.gov
and fsis.usda.gov.Useafoodthermometertotake
food temperatures and check several locations.
■
Do not allow anyone to climb, stand, or hang on the
oven door, drawer, or cooktop. They could damage
the range or tip it over, causing severe injury or death.
WARNING COOKTOP SAFETY INSTRUCTIONS
■ Never leave the surface units unattended. Boilovers
cause smoking and greasy spillovers that may
ignite.
■ Neverleaveoilunattendedwhilefrying.Ifallowed
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
cabinets.Useadeepfatthermometerwhenever
possible to monitor oil temperature.
■ Toavoidoilspilloverandfire,useaminimum
amount of oil when shallow pan-frying and avoid
cooking frozen foods with excessive amounts of ice.
■ Useproperpansize—selectcookwarehaving
flat bottoms large enough to cover the surface
heating element. The use of undersized cookware
will expose a portion of the surface unit to direct
contact and may result in ignition of clothing. Proper
relationship of cookware to surface unit will also
improve efficiency.
■ Whenusingglass/ceramiccookware,makesureit
is suitable for cooktop service; others may break
because of sudden change in temperature.

49-2000993 Rev. 1 5
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface. Do not use any sharp items to remove the film.
Remove all of the film before using the appliance for the
first time
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
Consider recycling options for your appliance packaging
material.
WARNING COOKTOP SAFETY INSTRUCTIONS
■ Tominimizethepossibilityofburns,ignitionof
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby surface units.
■ Whenpreparingflamingfoodsunderahood,turn
the fan on.
■ Ifpowerislosttoanelectriccooktopwhileasurface
unit is ON, the surface unit will turn back on as soon
as power is restored.
■ Intheeventofpowerloss,failuretoturnallsurface
unit knobs to the OFF position may result in ignition
of items on or near the cooktop, leading to serious
injury or death.
■ Donotcookonabrokencooktop.Ifglasscooktop
should break, cleaning solutions and spillovers
may penetrate the broken cooktop and create a
risk of electric shock. Contact a qualified technician
immediately.
■ Avoidscratchingtheglasscooktop.Thecooktop
can be scratched with items such as knives, sharp
instruments, rings or other jewelry, and rivets on
clothing.
■ Donotplaceorstoreitemsthatcanmeltorcatch
fire on the glass cooktop, even when it is not being
used. If the cooktop is inadvertently turned on, they
may ignite. Heat from the cooktop or oven vent after
it is turned off may cause them to ignite also.
■ Useceramiccooktopcleanerandnon-scratch
cleaning pad to clean the cooktop. Wait until the
cooktop cools and the indicator light goes out
before cleaning. A wet sponge or cloth on a hot
surface can cause steam burns. Some cleaners can
produce noxious fumes if applied to a hot surface.
NOTE: Sugar spills are an exception. They should
be scraped off while still hot using an oven mitt
and a scraper. See the Cleaning the glass cooktop
section for detailed instructions.
WARNING OVEN SAFETY INSTRUCTIONS
■ Keeptheovenventunobstructed.
■ Standawayfromtherangewhenopeningtheoven
door. Hot air or steam which escapes can cause
burnstohands,faceand/oreyes.
■ Placeovenracksindesiredlocationwhileovenis
cool. If rack must be moved while oven is hot, do not
let pot holder contact hot heating element in oven.
■ Neverplacecookingutensils,pizzaorbakingstones,
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.
■ Donotleaveitemsonthecooktopneartheoven
vent. Items may overheat resulting in a risk of fire or
burns.
■ Donotleaveitemssuchaspaper,cookingutensils
or food in the oven when not in use. Items stored in
an oven can ignite.
WARNING RADIANT COOKTOP SAFETY INSTRUCTIONS
Usecarewhentouchingthecooktop.Theglasssurfaceofthecooktopwillretainheatafterthecontrolshave
been turned off. Clean cooktop With Caution – If a wet sponge or cloth is used to wipe spills on a hot cooking
area, be careful to avoid steam burn. Some cleaners can produce noxious fumes if applied to a hot surface.
PROPER DISPOSAL OF YOUR APPLIANCE
Dispose of or recycle your appliance in accordance with Federal and Local Regulations. Contact your local
authorities for the environmentally safe disposal or recycling of your appliance.

649-2000993 Rev. 1
USING THE RANGE:SurfaceUnits
Surface Units
Throughout this manual, features and appearance may vary from your model.
How to Set
Push the knob in and turn in either direction to the
setting you want.
A surface ON indicator light will glow when any surface
unit is on
For glass cooktop surfaces:
A HOT COOKTOP indicator light will:
■ comeonwhentheunitishottothetouch.
■ stayonevenaftertheunitisturnedoff.
■ stayonuntiltheunitiscooledto
approximately 150°F.
WARNING FIRE HAZARD: Never leave the range unattended with the cooktop on medium or high settings.
Keepflammableitemsawayfromthecooktop.Turnoffallcontrolswhendonecooking.Failureto
follow these instructions can result in fire, serious injury or death.
Dual Surface Units and Control Knobs (on some models)
The surface unit has 2 cooking sizes to select from so
you can match the size of the unit to the size of the
cookware you are using.
At both OFF and HI the control clicks
into position. You may hear slight
clicking sounds during cooking,
indicating the control is maintaining
your desired setting.
Be sure you turn the control knob to
OFF when you finish cooking.
Models with a Dual-Ring
surface element only
Melt setting (on some models)
will melt chocolate or butter.

49-2000993 Rev. 1 7
Surface Units (Cont.)
Using the Warming Zone
WARNING
FOOD POISON HAZARD: Bacteria may grow in food at
temperatures below 140°F.
■ Always start with hot food. Do not use warm setting to
heat cold food.
■ Do not use warm setting for more than 2 hours.
The WARMING ZONE, located in the back center of
the glass surface, will keep hot, cooked food at serving
temperature. Always start with hot food. Do not use to
heat cold food. Placing uncooked or cold food on the
WARMING ZONE could result in foodborne illness.
To use the WARMING ZONE:
Press the WARMING ZONE pad, select the desired level
(1, 2 or 3) using the number pads, and press start.
To turn off the WARMING ZONE:
Press the WARMING ZONE pad.
NOTE: Cancel/OffwillNOTturnoffthewarmingzone.
For best results, all foods on the WARMING ZONE
should be covered with a lid or aluminum foil. When
warming pastries or breads, the cover should be vented
to allow moisture to escape.
The initial temperature, type and amount of food, type of
pan, and the time held will affect the quality of the food.
Always use pot holders or oven mitts when removing
food from the WARMING ZONE, since cookware and
plates will be hot.
NOTE: The surface warmer will not glow red.
USING THE RANGE: SurfaceUnits
Home Canning Tips
Be sure the canner is centered over the surface unit.
Make sure the canner is flat on the bottom.
To prevent burns from steam or heat, use caution when
canning.
Userecipesandproceduresfromreputablesources.
These are available from manufacturers such as Ball®
andKerr®and the Department of Agriculture Extension
Service.
Flat-bottomedcannersarerecommended.Useofwater
bath canners with rippled bottoms may extend the time
required to bring the water to a boil.

849-2000993 Rev. 1
Temperature Limiter on Radiant Glass Cooktops
Every radiant surface unit has a temperature limiter.
The temperature limiter protects the glass cooktop from
getting too hot.
The temperature limiter may cycle the surface units off
for a time if:
■ thepanboilsdry.
■ thepanbottomisnotflat.
■ thepanisoff-center.
■ thereisnopanontheunit.
Radiant Glass Cooktop
The radiant cooktop features heating units beneath a
smooth glass surface.
NOTE: A slight odor is normal when a new cooktop is
used for the first time. It is caused by the heating of new
parts and insulating materials and will disappear in a
short time.
NOTE: On models with light-colored glass cooktops, it is
normal for the cooking zones to change color when hot
or cooling down. This is temporary and will disappear as
the glass cools to room temperature.
The surface unit will cycle on and off to maintain your
selected control setting.
It is safe to place hot cookware on the glass surface
even when the cooktop is cool.
Even after the surface units are turned off, the glass
cooktop retains enough heat to continue cooking. To
avoid overcooking, remove pans from the surface units
when the food is cooked. Avoid placing anything on the
surface unit until it has cooled completely.
■ Waterstains(mineraldeposits)areremovableusing
the cleaning cream or full-strength white vinegar.
■ Useofwindowcleanermayleaveaniridescentfilmon
the cooktop. The cleaning cream will remove this film.
■ Don’tstoreheavyitemsabovethecooktop.Ifthey
drop onto the cooktop, they can cause damage.
■ Donotusethesurfaceasacuttingboard.
Surface Units (Cont.)
Never cook directly on the glass. Always
use cookware.
Always place the pan in the center of the
surface unit you are cooking on.
Do not slide cookware across the cooktop because
itcanscratchtheglass—theglassisscratch-
resistant, not scratch proof.
USING THE RANGE:SurfaceUnits

49-2000993 Rev. 1 9
Cookware for Radiant Glass Cooktop
USING THE RANGE: Cookware for Radiant Glass Cooktop
The following information will help you choose cookware which will give good performance on glass cooktops.
NOTE: Follow all cookware manufacturer’s recommendations when using any type of cookware on the ceramic cooktop.
Recommended
Stainless Steel
Aluminum:
heavy weight recommended
Good conductivity. Aluminum residues
sometimes appear as scratches on the
cooktop but can be removed if cleaned
immediately. Because of its low melting
point, thin weight aluminum should not
be used.
Copper Bottom:
Copper may leave residues which can
appear as scratches. The residues can
be removed, as long as the cooktop
is cleaned immediately. However, do
not let these pots boil dry. Overheated
metal can bond to glass cooktops. An
overheated copper bottom pot will leave
a residue that will permanently stain the
cooktop if not removed immediately.
Enamel (painted) on Cast Iron:
recommended if bottom of pan is coated
Avoid/Not Recommended
Enamel (painted) on Steel:
Heating empty pans can cause
permanent damage to cooktop glass.
The enamel can melt and bond to the
ceramic cooktop.
Glass-ceramic:
Poor performance. Will scratch the
surface.
Stoneware:
Poor performance. May scratch the
surface.
Cast Iron:
notrecommended—unlessdesigned
specifically for glass cooktops
Poor conductivity and slow to absorb
heat. Will scratch the cooktop surface.
Check pans for flat bottoms by
using a straight edge.
Pans with rounded, curved,
ridged or warped bottoms are
not recommended.
For Best Results
■ Placeonlydrypansonthesurfaceelements.Donot
place lids on the surface elements, particularly wet lids.
Wet pans and lids may stick to the surface when cool.
■ Donotusewoksthathavesupportrings.Thistypeof
wok will not heat on glass surface elements.
■ Werecommendthatyouuseonlyaflat-bottomed
wok. They are available at your local retail store. The
bottom of the wok should have the same diameter as
the surface element to ensure proper contact.
■ Somespecialcookingproceduresrequirespecific
cookware such as pressure cookers or deep-fat
fryers. All cookware must have flat bottoms and be
the correct size.
Do not place wet pans on the glass cooktop.
Do not use woks with support rings on the glass cooktop.
Useflat-bottomedwoksontheglasscooktop.

10 49-2000993 Rev. 1
1. Upper Oven and Lower Oven:
Designates which oven the controls will operate.
Select an oven before following the steps for
starting a cooking or cleaning mode.
2. Convection Cooking Modes: Convection
cooking modes use increased air circulation to
improve performance. See the Cooking Modes
section for more information.
3. Traditional Cooking Modes: Your oven
has the following traditional cooking modes: Bake,
Broil, and Warm. See the Cooking Modes section
for more information.
4. Clean: Your oven has one cleaning mode:
Steam Clean. See the Cleaning the Oven section
for important information about using this mode.
5. Start/Enter: Must be pressed to start any
cooking, cleaning, or timed function. Also used to
start the Warming Zone on the cooktop.
6. Cancel/Off: Cancels ALL oven operations
except the clock and timer. Does NOT cancel the
Warming Zone on the cooktop.
7. Timer: Works as a countdown timer. Press the
Timer pad and number pads to program the time in
hours and minutes. Press the Start pad. When the
timer countdown is complete, press the Timer pad
to turn the timer off.
8. Oven Light: Turns the oven light on or off.
9. Lock Controls: Locks out the control so that
pressing the pads does not activate the controls.
Press and hold the 0 pad, for three seconds to lock
or unlock the control. Cancel/Off is always active,
even when the control is locked.
10. Cooking Options and Settings: The
Cooking Options and Settings pads open up more
detailed menus in the display that allow access to
additional functions and cooking modes. For each
you select the function in the display using the
associated number pad. You can exit at any time
by pressing the Cooking Options or Settings pad
again. See the Settings, Cooking Options, and
Cooking Modes Sections for more details.
11. Warming Zone: See the warming zone section
for important information about using this mode.
USING THE RANGE: Oven Controls
Oven Controls
58
910
6
311 7
1
1
24

49-2000993 Rev. 1 11
Cooking Options
USING THE RANGE: Cooking Options
The Cooking Options pad opens up a menu of more cooking modes when the oven is off. It opens a menu with
additional features if a cooking mode is already in process. You can exit the menu at any time by pressing the
Cooking Options pad again.
You must first select an oven and a mode (bake, convection bake, convection roast) and then select Cooking
Options to get to the following functions.
Cook Time
Counts down cooking time and turns off the oven when
the cooking time is complete. Select a desired cooking
mode.Usethenumberpadstoprogramabaking
temperature. Press the Cooking Options pad and
select Cook Time.Usethenumberpadtoprogram
cook time in hours and minutes. Then press Start/Enter.
This can only be used with Bake, Convection Bake, and
Convection Roast.
Delay Time
Delayswhentheovenwillturnon.Usethistoseta
time when you want the oven to start. Press the desired
cookingmodepad.Usethenumberpadtoprograma
baking temperature. Press the Cooking Options pad
and select Delay Time.Usethenumberpadstoprogram
the time of day for the oven to turn on, and then press
Start/Enter. Delay Time is not available with all modes.
NOTE: When using the Delay Time feature, foods that
spoil easily – such as milk, eggs, fish, stuffing, poultry,
and port – should not be allowed to sit for more than
1 hour before or after cooking. Room temperature
promotes the growth of harmful bacteria. Be sure that the
oven light is off because heat from the bulb will speed
harmful bacteria growth.

12 49-2000993 Rev. 1
Settings
The Cooking Options and Settings pads open up more detailed menus in the display that allow access to
additional functions. For each you select the function in the display using the associated number pad. You
can exit at any time by pressing the Cooking Options or Settings pad again.
Clock
This setting sets the oven clock time. Press the Settings
pad and select Clock. Follow the instructions to set the
clock. This feature also specifies how the time of day will
be displayed. You can select a standard 12-hour clock
(12H), 24-hour military time display (24H), or no clock
displayed (Off). Press the Settings pad, select Clock
and select either 12/24 hr or On/Off.
Auto Conv (Auto Conversion)
When using Convection Bake cooking, Auto Recipe
Conversion will automatically convert the regular baking
temperatures entered to convection bake cooking
temperatures when turned on. Note that this option does
not convert convection bake cooking times, it only converts
temperatures. This feature may be turned On or Off.
Select Settings and Auto Conversion, then follow the
prompts to turn this feature on or off.
Auto Off
This feature shuts the oven down after 12 hours of
continuous operation. It may be enabled or disabled.
Select Settings, More, and Auto Off to turn this feature
on or off.
Sound
You can adjust the volume and type of alert your appliance
uses. Select Settings, More, and Sound. Follow prompts
for making volume adjustments or for changing between
continuous and single alert tones. A continuous setting will
continue to sound a tone until a button on the control is
pressed. The oven tone volume can be adjusted between
several settings and off. The control will sound the oven
tone at the new volume level each time the sound level is
changed.
F/C (Fahrenheit or Celsius)
The oven control is set to use Fahrenheit temperatures
(F), but you can change it to use Celsius temperatures
(C). Select Settings, More, and F/C to alter between
temperature scales displayed.
Adjust the Oven temperature
This feature allows the oven cooking modes to be
adjustedupto35ºFhotterordownto35ºFcooler.Use
this feature if you believe your oven temperature is too
hot or too cold and wish to change it. This adjustment
affects Bake and Convection Bake modes. No other
cooking modes are affected. Select Settings and Oven
Adj to add More Heat or Less Heat and then press
Save (for double ovens use the Upper Oven or Lower
Oven menu selection corresponding to the oven to be
adjusted).
Oven Info
To display the model number and software version on
your unit, select Settings, More, and Oven Info.
USING THE RANGE: Settings

49-2000993 Rev. 1 13
TheSabbathmodefeaturecomplieswithstandardssetforthbyStarK.Someofthesestandardsthatwillbenoticed
by the consumer include the disabling of tones, disabling of oven lights, and delays of about 30 seconds to one
minute on display changes. Only continuous baking or timed baking is allowed in the Sabbath mode. Cooking in the
Sabbath mode is a two-step process, first the Sabbath mode must be set and then the bake mode must be set.
Setting the Sabbath Mode
Press the Settings pad, select Sabbath, and select
Turn on. A single bracket “]” will appear in the display
indicating that the Sabbath mode is set. The clock will not
be displayed. Continuous bake or timed bake can now be
programmed.
Starting a Continuous Bake
1. Press the Bake pad. (For double ovens, this operates
the upper oven. If desiring to use Lower Oven, press
Lower Oven and then Bake.)
2. If the desired temperature is 350F, press Start/
Enter. If a different cooking temperature is desired,
use the 1through 5number pads to select a preset
cooking temperature, then press Start/Enter. Refer
to the graphic below to determine which pad sets the
desired cooking temperature.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking.
Adjusting the Temperature
Press Bake (or press Lower Oven and then Bake for
lower oven in a double oven unit), use the 1through
5number pads to select a different preset cooking
temperature, and press Start/Enter.
Starting a Timed Bake
1. Press the Bake pad.
2. If the desired temperature is 350F, use the 6through
0number pads to select a cooking time. If a cooking
temperature other than 350F is desired, use the 1
through 5number pads to select a preset cooking
temperature, then select the cooking time. Refer to
the graphic on this page to determine which pad sets
the desired cooking temperature and cooking time.
3. Press Start/Enter.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking. When the cook
time expires, the display will change back to a single
bracket “]” indicating that the oven is no longer baking.
No tone will sound when the cook time is complete.
Exit the Sabbath Mode
Exiting the Sabbath mode should be done after the
Sabbath is over.
1. Press Cancel/Off to end any bake mode that may be
running.
2. Press and hold Settings pad until Sabbath Mode off
is displayed.
Sabbath Mode Power Outage Note
If a power outage occurs while the oven is in Sabbath
Mode, the unit will return to Sabbath Mode when power
is restored, however the oven will return to the off state
even if it was in the middle of a bake cycle when the
power outage occurred.
Sabbath Mode
USING THE RANGE: Sabbath Mode
Temperature (°F)
Time (hours)
200
325
2.5h
250
400
3h
4h
300
2h
3.5h
1 = 200° F, 2 = 250° F, 3 = 300° F, 4 = 325° F, 5 = 400° F
6 = 2 hours, 7 = 2.5 hours, 8 = 3 hours, 9 = 3.5 hours, 0 = 4 hours

14 49-2000993 Rev. 1
Recommended rack positions for various types of
foods are provided in the Cooking Guide. Adjusting
rack position is one way to impact cooking results. For
example, if you would prefer darker tops on cakes,
muffins, or cookies, try moving food one rack position
higher. If you find foods are too brown on top try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is at least 1½" between pans to allow
sufficient space for air to flow.
To avoid possible burns, place the racks in the desired
position before you turn the oven on.
USING THE RANGE:OvenRacks/AluminumFoilandOvenLiners/Cookware
Oven Racks
Cookware
Cookware Guidelines
The material, finish, and size of cookware affect baking
performance.
Dark, coated and dull pans absorb heat more readily
than light, shiny pans. Pans that absorb heat more
readily can result in a browner, crisper, and thicker crust.
If using dark and coated cookware check food earlier
than minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
oven temperature by 25ºF next time.
Shiny pans can produce more evenly cooked baked
goods such as cakes and cookies.
Glass and ceramic pans heat slowly but retain heat well.
These types of pans work well for dishes such as pies
and custards.
Air insulated pans heat slowly and can reduce bottom
browning.
Keepcookwarecleantopromoteevenheating.
CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foil may be used to catch spills by placing a sheet on a lower rack, several inches below the food. Do not use more
foilthannecessaryandneverentirelycoveranovenrackwithaluminumfoil.Keepfoilatleast1-1/2”fromovenwalls
to prevent poor heat circulation.
Aluminum Foil and Oven Liners
The number of rack positions may vary by model.

49-2000993 Rev. 1 15
USING THE RANGE: Cooking Modes
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Cooking Guide section for rack position and other recommendations for specific modes and foods.
Bake
The bake mode is for baking and roasting. When
preparing baked goods such as cakes, cookies and
pastries, always preheat the oven first. To use this
mode press the Bake pad, enter a temperature with the
number pads, and then press Start/Enter.
Warm
Warm mode is designed to keep hot foods hot. Cover
foods that need to remain moist and do not cover foods
that should be crisp. Preheating is not required. Do
not use warm to heat cold food It is recommended that
food not be kept warm for more than 2 hours. Press the
Warm pad and then press Start/Enter.
Broiling Modes
Always broil with the oven door closed. Monitor food
closelywhilebroiling.Usecautionwhenbroiling:placing
food close to the broil element increases smoking,
spattering and the possibility of fats igniting. It is not
necessary to preheat when using the Broil modes.
Broil Hi
The Broil Hi mode uses intense heat from the upper
elementtosearfoods.UseBroilHiforthinnercuts
ofmeatand/orwhenyouwouldliketohaveaseared
surface and rare interior. To use this mode press the
Broil pad once and then press Start/Enter.
Broil Lo
The Broil Lo mode uses less intense heat from the upper
element to cook food thoroughly while also browning the
surface.UseBroilLoforthickercutsofmeatand/orfoods
that you would like cooked all the way through. To use
this mode press the Broil pad twice and then press Start/
Enter.
Convection Bake
The Convection Bake mode is intended for baking
on multiple racks at the same time. This mode uses
air movement from the convection fan to enhance
cooking evenness. Your oven is equipped with Auto
Recipe Conversion, so it is not necessary to adjust the
temperature when using this mode. Always preheat
when using this mode. Baking times may be slightly
longer for multiple racks than what would be expected
for a single rack. To use this mode press the Conv Bake
pad, enter a temperature with number pads, and then
press Start/Enter.
Convection Roast
The Convection Roast mode is intended for roasting
whole cuts of meat on a single rack. This mode uses
movement from the convection fan to improve browning
and reduce cooking time. It is not necessary to convert
temperature. Check food earlier than the recipe
suggested time when using this mode, or use the probe.
To use this mode press the Conv Roast pad, enter a
temperature with the number pads, and then press Start/
Enter.
Proof
Proof mode maintains a warm environment for rising
yeast-leavened dough move this to the end of the Proof
section.
If the oven is too warm, Proof mode will not operate and
the display will show "Oven too hot for Proof".
For best results, cover the dough while proofing and
check early to avoid over-proofing.
CAUTION Do not use the Proof mode for warming
food or keeping food hot. The proofing oven temperature
is not hot enough to hold foods at safe temperatures.
Air Fry (Lower Oven Only)
(on some models)
Air Fry is a special, no-preheat, cooking mode that is
designed to produce foods with a crispier exterior than
traditional oven cooking. The Air Fry mode is intended
for single rack cooking only. Select Air Fry, then input
the desired set temperature and press Start. The
temperature can be set between 300°F and 500°F.
Preheating is not recommended for this mode. Follow
traditional oven recipe or package guidelines for set
temperatures and cook times; adjust cook time to
achieve your desired crispness. Additional guidelines
for using this mode can be found in the Air Fry Cooking
Guide.
Pre-Heat
Proper preheating ensures that the oven is hot enough
to begin baking. Improper preheating (that is, cooking
in the oven that has not come up to set temperature)
can negatively affect cooking. Depending on the recipe
recommendations, the temperature of your foods when
they go into the oven may determine your final baking
time and baking results; if you put your food, such as
biscuits or breads, in during Pre-heat, they may over
brown on top or burn.
IMPORTANT: The more items to be heated in the oven
during preheat (this includes multiple racks, baking
stones, etc.) will affect the length of your pre-heat time.
Always begin baking after the pre-heat signal. The signal
will be a beep, indicaotr light or chime. This lets you
know your oven is at your needed baking temperature.
For best results, turn the oven On before you begin your
prep work.
Cooking Modes

16 49-2000993 Rev. 1
USING THE RANGE: Cooking Guide
FOOD TYPE
RECOMMENDED
MODE(S)
OVEN
(Upper / Lower)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer Cakes, sheet cakes,
bundt cakes, muffins, quick
breads on a Single Rack
Bake Upper
Lower
1
3Useshinycookware.
Layer cakes* on Multiple
Racks
Bake
Convection Bake Lower 2 and 4 Ensure adequate airflow
(see illustration below).
Chiffon cakes (angel food) Baked Goods Lower 1 Useshinycookware.
Cookies, biscuits, scones on
a Single Rack Bake Upper
Lower
1
3Useshinycookware.
Cookies, biscuits, scones on
Multiple Racks Convection Bake Lower 2 and 4 Ensure adequate airflow.
Yeast Breads
Proof Upper
Lower
1
3Cover dough loosely
Bake Upper
Lower
1
3
Beef & Pork
Hamburgers Broil High Lower 6
Useabroilpan;movefooddownformore
doneness/lesssearing.Watchfoodcloselywhen
broiling. For best performance center food below
the broil heating element
Steaks & Chops Broil High Lower 5 or 6
Useabroilpan;movefooddownformore
doneness/lesssearing.Watchfoodcloselywhen
broiling. For best performance center food below
the broil heating element
Roasts Bake
Convection Roast Lower 2 or 3 Usealowsidedpansuchasabroilpan.
Preheating is not necessary
Poultry
Whole chicken Bake
Convection Roast Lower 2 or 3 Usealowsidedpansuchasabroilpan.
Bone-in chicken breasts,
legs, thighs
Broil Low
Bake
Upper
Lower
1
3
If breaded or coated in sauce avoid Broil Hi modes.
Broil skin side down first. Watch food closely when
broiling. For best performance when broiling,
center food below the broil heating element.
Boneless chicken breasts Broil Low
Bake
Upper
Lower
1
3
If breaded or coated in sauce avoid Broil Hi modes.
Broil skin side down first. Watch food closely when
broiling. For best performance when broiling,
center food below the broil heating element
Whole turkey Bake
Convection Roast Lower 1 Usealowsidedpansuchasabroilpan.
Turkey Breast Bake
Convection Roast Lower 2 or 3 Usealowsidedpansuchasabroilpan.
Fish Broil Low Lower 6(1/2thickorless)
5(>1/2inch)
Watch food closely when broiling. For best performance
center food below the broil heating element.
Casseroles Bake Upper
Lower
1
3 or 4
*When baking four cake layers at a time, use racks
2 and 4.
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov.Useafoodthermometertotake
food temperatures.
Cooking Guide
Baking four cake layers at a time
Rear Placement
Front Placement

49-2000993 Rev. 1 17
USING THE RANGE: Air Fry Cooking Guide
Air Fry is a special, no-preheat, cooking mode that
is designed to produce foods with a crispier exterior
than traditional oven cooking. Select Air Fry, then
input the desired set temperature and press Start. The
temperature can be set between 300°F and 500°F.
Air Fry Cookware Guidelines
• Only use broil safe cookware when using Air Fry mode.
• A dark sheet pan is recommended. A dark pan
promotes better browning and crisping.
• Oven baking baskets and baking grids can also be
used. A sheet pan should be placed on the rack below
the foods to catch any drippings when using a baking
basket.
General Tips for Air Fry Mode
• The Air Fry mode is designed for cooking on a single
rack.
• The Air Fry mode is designed to be used without
preheating.
• Rack position 3 is recommended for most foods.
• Foods may cook faster than expected if the oven is
already hot when food is placed in the oven.
• When air frying foods with sauce, it is recommended to
apply the sauce at the end of cooking.
• If foods are browning too quickly, try a lower rack
position or lower oven set temperature.
• For packaged foods, use traditional oven cooking
instructions for set temperature and expected cook
time.
• It is not necessary to flip or stir food during cooking
• Arrange food in a single layer on the pan, do not
overload the pan.
• Always check internal food temperature to confirm
minimum safe temperatures have been reached.
Minimum safe food temperatures can be found on
packages and at IsItDoneYet.gov.
FOOD TYPE
RECOMMENDED
RACK POSITION(S)
RECOMMENDED
SET TEMPERATURES (F°)
RECOMMENDED
COOK TIME (MIN) NOTES
Fresh boneless fish or
poultry pieces, breaded such
as nuggets, tenders, fillets
3 375-400 15-30 Userlowersettemperaturesforlargerpieces.
Useshinycookware.
Fresh bone in
chicken wings 3 375-400 25-40 Salt wings or coat in a dry rub, if using sauce
apply after cooking or toward the end of cooking
Fresh bone in chicken
drumsticks or thighs 3 375-400 30-55 Userlowersettemperaturesforlargerpieces.
Fresh French fries,
thin (< ½ inch) 3 400-425 15-30
Parchment paper is recommended when
preparing fresh French fries. For crispier fries,
toss fries in corn starch or rice flour before
cooking.
Fresh French fries,
thick (> ½ inch) 3 375-400 20-35
Parchment paper is recommended when
preparing fresh French fries. For crispier fries,
toss fries in corn starch or rice flour before
cooking.
Frozen packaged
foods 3
Usetraditionaloven(notAirFry)cookinginstructionsasaguidelineforsettemperatureandcooktime.Additional
cook time beyond recommended package time may be required for some foods. If oven is hot when starting, food
may cook faster than the minimum package time.
Primary recommended cookware
Alternate cookware options
Air Fry Cooking Guide (Lower Oven Only) (on some models)

18 49-2000993 Rev. 1
Cleaning the Range – Exterior
A child or adult can tip the range and be killed.
Verify the anti-tip bracket has been properly installed
and engaged.
Ensure the anti-tip bracket is re-engaged when the range
is moved.
Do not operate the range without the anti-tip bracket in
place and engaged.
Failure to follow these instructions can result in death or
serious burns to children or adults.
Tip-Over Hazard
WARNING
WARNING If your range is removed for cleaning, servicing or any reason, be sure the
anti-tip device is reengaged properly when the range is replaced. Failure to
take this precaution could result in tipping of the range and can result in death
or serious burns to children or adults.
Be sure all controls are off and all surfaces are cool before cleaning any part of the range.
Control Lockout
If desired, the touch pads may be deactivated before
cleaning.
See Lock Controls in the Oven Controls section in this
manual.
Clean up splatters with a damp cloth.
You may also use a glass cleaner.
Remove heavier soil with warm, soapy water. Do not use
abrasives of any kind.
Reactivate the touch pads after cleaning.
Control Panel
It’s a good idea to wipe the control panel after each use.
Clean with mild soap and water or vinegar and water,
rinse with clean water and polish dry with a soft cloth.
Do not use abrasive cleansers, strong liquid cleansers,
plastic scouring pads or oven cleaners on the control
panel—theywilldamagethefinish,includingBlack
Stainless Steel.
Oven Exterior
Do not use oven cleaners, abrasive cleansers, strong
liquid cleansers, steel wool, plastic scouring pads, or
cleaning powders on the exterior of the oven. Clean with
a mild soap and water or vinegar and water solution.
Rinse with clean water and dry with a soft cloth. When
cleaning surfaces, make sure that they are at room
temperature and not in direct sunlight.
If stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up immediately. Let hot surfaces
cool, then clean and rinse.
Painted Surfaces and Black Stainless Steel
Painted surfaces include the sides of the range and the
door, top of control panel and the drawer front. Clean
these with soap and water or a vinegar and water solution.
Do not use commercial oven cleaners, cleaning
powders, steel wool or harsh abrasives on any painted
surface, including Black Stainless Steel.
Stainless Steel (on some models)
Do not use a steel wool pad; it will scratch the surface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end
of this manual.
CARE AND CLEANING:CleaningtheRange–Exterior/Interior
Cleaning the Range – Interior
The interior of your new oven can be cleaned manually or by using Steam Clean or Self Clean modes.
Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration and
should be wiped up immediately. Let hot surfaces cool, then clean and rinse.
Manual Cleaning
Do not use oven cleaners (unless certified for self-
cleaning oven), strong liquid cleansers, steel wool,
or scouring pads on the interior of the oven. For soils
on the oven bottom and other enameled surfaces,
use a gentle abrasive containing oxalic acid, such as
BarKeepersFriend®,withanon-scratchsponge.Take
care not to apply any abrasive cleaners or sponges to
the door glass, as it will scratch the reflective coating.
The oven interior and door glass may be cleaned using
a soft cloth with a mild soap and water, or vinegar and
water solution. After cleaning, rinse with clean water and
dry with a soft cloth.

49-2000993 Rev. 1 19
USING THE RANGE:CleaningtheRange–Interior/CleaningtheGlassCooktop
Cleaning the Range – Interior
Racks
All racks can be washed with warm, soapy water.
Enameled (not shiny) racks can be left in the cavity
during self clean.
Racks may be more difficult to slide, especially after
a self-clean. Put some vegetable oil on a soft cloth or
paper towel and rub onto the left and right edges.
NOTE: Usingothercookingoilswillcauseadiscoloring
or a rust like color residue on the racks and cavity sides.
To clean this residue, use a soap and water or a vinegar
and water solution. Rinse with clean water and dry with a
soft cloth.
Steam Clean Mode
The Steam Clean feature is for cleaning light soil from
your oven at a lower temperature than Self Clean.
To use the Steam Clean feature:
1. Start with the oven at room temperature.
2. Wipe excess grease and soils from the oven.
3. Pour one cup of water onto the bottom of the oven.
4. Close the door.
5. Press Upper Oven or Lower Oven, press the
Clean pad, select Steam Clean and then press
Start/Enter.
Do not open the door during the 30 minute steam clean
as this will decrease the steam clean performance.
At the end of the Steam Clean cycle, soak up the
remaining water, and wipe the moisture-softened soil
from the oven walls and door.
Oven Heating Elements
Do not clean the bake element or the broil element. Any
soil will burn off when the elements are heated.
The bake element is not exposed and is under the oven
floor. Clean the oven floor with warm, soapy water.
Wipe up heavy soil on the oven bottom.
To maintain and protect the surface of your glass cooktop,
follow these steps:
1. Before using the cooktop for the first time, clean it
with a ceramic cooktop cleaner. This helps protect the
top and makes cleanup easier.
2. Regular use of ceramic cooktop cleaner will help keep
the cooktop looking new.
3. Shake the cleaning cream well. Apply a few drops of
ceramic cooktop cleaner directly to the cooktop.
4. Useapapertowelornon-scratchcleaningpadfor
ceramic cooktops to clean the entire cooktop surface.
5. Useadryclothorpapertoweltoremoveallcleaning
residue. No need to rinse..
NOTE: It is very important that you DO NOT heat the
cooktop until it has been cleaned thoroughly.
Cleaning the Glass Cooktop
Clean your cooktop after each
spill.Useaceramiccooktop
cleaner.
Ceramic
Cooktop
Cleaner
For cleaning videos and
instructions, scan the QR
code with your device.

20 49-2000993 Rev. 1
Heavy, Burned-On Residue
1. Allow the cooktop to cool.
2. Useasingle-edgerazorbladescraperatapproximately
a 45° angle against the glass surface and scrape the
soil. It will be necessary to apply pressure to the razor
scraper in order to remove the residue.
3. After scraping with the razor scraper, spread a few drops
of ceramic cooktop cleaner on the entire burned residue
area.Useanon-scratchcleaningpadtoremoveany
remaining residue.
4. For additional protection, after all residue has been
removed, polish the entire surface with ceramic
cooktop cleaner and a paper towel.
The ceramic cooktop scraper
and all recommended supplies
are available through our Parts
Center. See the Accessories
and Consumer Support
sections at the end of this
manual.
NOTE: Do not use a dull or
nicked blade.
Metal Marks and Scratches
1. Be careful not to slide pots and pans across your
cooktop. It will leave metal markings on the cooktop
surface.
These marks are removable using the ceramic
cooktop cleaner with a non-scratch cleaning pad for
ceramic cooktops.
2. If pots with a thin overlay of aluminum or copper
are allowed to boil dry, the overlay may leave black
discoloration on the cooktop.
This should be removed immediately before heating
again or the discoloration may be permanent.
NOTE: Carefully check the bottom of pans for roughness
that would scratch the cooktop.
3. Be careful not to place aluminum baking sheets or
aluminum frozen entrée containers on a hot cooktop
surface. It will leave shinny dots or markings on the
cooktop surface. These markings are permanent and
cannot be cleaned off.
Damage from Sugary Spills and Melted Plastic
Special care should be taken when removing hot substances to avoid permanent damage of the glass surface.
Sugary spillovers (such as jellies, fudge, candy, syrups) or melted plastics can cause pitting of the surface of your
cooktop (not covered by the warranty) unless the spill is removed while still hot. Special care should be taken when
removing hot substances.
Be sure to use a new, sharp razor scraper.
Do not use a dull or nicked blade.
1. Turn off all surface units. Remove hot pans.
2. Wearing an oven mitt:
a. Useasingle-edgerazorbladescrapertomove
the spill to a cool area on the cooktop.
b. Remove the spill with paper towels.
3. Any remaining spillover should be left until the surface
of the cooktop has cooled.
4. Don’t use the surface units again until all of the
residue has been completely removed.
NOTE: If pitting or indentation in the glass surface has
already occurred, the cooktop glass will have to be
replaced. In this case, service will be necessary.
Cleaning the Glass Cooktop (Cont.)
CARE AND CLEANING: Cleaning the Glass Cooktop
Burned-On Residue
NOTE: DAMAGE to your glass surface may occur if you
use scrub pads other than those recommended.
1. Allow the cooktop to cool.
2. Spread a few drops of ceramic cooktop cleaner on
the entire burned residue area.
3. Usinganon-scratchcleaningpadforceramic
cooktops, rub the residue area, applying pressure as
needed.
4. If any residue remains,
repeat the steps listed
above as needed.
5. For additional protection,
after all residue has been
removed, polish the entire
surface with ceramic
cooktop cleaner and a
paper towel.
Useanon-scratchcleaningpadfor
Ceramic Cooktops.
Other manuals for JSS86
1
Table of contents
Other GE Range manuals