Beltronics Vector 990 User manual

Head Office
2422 Dunwin Drive
Mississauga, Ontario
Canada L5L 1J9
Tel: [phone] Fax: [phone]
wwwwww..bbeellttrroonniiccss..ccoomm
This product is subject to one or more of the following patents:
United States
#4,571,593 #4,625,210 #4,630,054 #4,939,521
#4,952,936 #4,961,074 #5,402,087 #5,446,923
#5,587,916 #5,600,132
Canada
#1,187,586 #1,187,602 #1,295,714 #1,295,715
Other Patents Pending
Safety Warning System®L.C.–Patents Pending
Printed in Canada 273004-13
,Fundamental Mixer Technology, FMT and Shadow Technology
are registered trademarks of BELTRONICS USA, Inc. VECTOR 990,
Total Tracking Laser, TTL, AccuSweep and AutoScan are trademarks of
BELTRONICS USA, Inc. Safety Warning System is a registered trademark
of Safety Warning System L.C.

VECTOR 990
VECTOR 990
Operating Instructions
MOTOROLAMOTOROLA
digitaldna
TM
MOTOROLA
Model V990
k
International
International
Digital
Voice and Text Messages
64
20
North American
Driver Selectable Features
International
Driver Selectable Features
16
THE NEXT GENERATION IN DIGITAL PERFORMANCE
THE NEXT GENERATION IN DIGITAL PERFORMANCE

CONGRATULATIONS!
SOFTWARE UPGRADABLE
SHADOW TECHNOLOGY®II
Thank you for purchasing VECTOR 990 International – the
world’s only truly International Radar detector. VECTOR 990
International contains 10 Radar frequencies making it ideal for
travel anywhere in the world. VECTOR 990 International
contains 16 North American Driver Selectable Features and 20
International Driver Selectable Features, 64 Digital Voice and
Text Messages, and the best possible Radar sensitivity in the
industry. Enjoy your new detector and be sure to obey all laws
where ever you may travel.
Remember, owning a Radar detector does not give you a
license to speed. Alerts from a Radar detector serve as an
effective reminder to check your speed. Laws vary throughout
the USA and Europe governing the use of a Radar detector.
It is your responsibility to follow these laws.
VECTOR 990 International contains Flash Technology which
provides the highest capability to be reprogrammed as the
threat of new police traffic radar monitoring technologies
emerge. Please ensure that you promptly send in your
Consumer Information card. This will ensure you are notified
about new traffic monitoring technologies as they emerge.
VECTOR 990
International contains Shadow
Technology® II making it undetectable to the
Interceptor VG-2 Radar Detector Detector.
Shadow Technology is activated at all times
– no button activity is required.
The custom Anodized Aluminum Travel
Case is designed to protect your unit
and its accessories when not in use.
Enjoy your new purchase and please
drive safely.

2
Includes 16 Driver Selectable Features
5 Operating Modes 11 General Features
Normal Mode
Modifications Mode
Quick-Start X Band (10.525 GHz) On/Off
Tech Mode
Voltage Meter Mode K Band (24.125 GHz) On/Off
Super Wideband Ka (33.4-36.0)
AccuSweep™
Operating modes are
Selected using PWR Button
See page 00.
AutoMute On/Off
Radar/Laser Digital Voice
Prompts On/Off
Safety Warning System™On/Off
Safety Warning System Digital
Voice or Tone
Audio/Visual Scroll Rate
Fast/Slow
Inverted Display Option
AutoScan
General Features selected by pressing
CTY button followed by the PWR
Button when the unit is off.
Operating Modes are
selected using the PWR button
(
see page 5 .)
General Selectable Features are
accessed by pressing the PWR and
CTY buttons simultaneously, when
the unit is off. (see page 11.)
Note: for convenience AutoScan
™
is accessed using the CTY button
(see page 9 .)
VECTOR 990 International provides more user Selectable Features
than any other detector on the market. Selectable Features allow you
to “customize” how alerts will be presented to you.
5Operating Modes
1. NORMAL Mode
A lengthy power up test
sequence; text messages identify
alerts received, i.e. “XXBBaanndd”.
2. MODIFICATIONS Mode
Full Power-up test sequence;
presents ONLY those General
Selectable Features which you
have altered from factory pre-set.
Text messages identify alerts received.
3. QUICK START Mode
No test sequence; unit immediately
shows last used traveling
mode:“AAuuttooSSccaann™”,
“HHiigghhwwaayy”, “ CCiittyyXX”
“CCiittyy
AALLLL
”, Text messages
identify alerts received.
4. TECH Mode
Full Power-up text sequence.
Text messages identify band received
followed by ACTUAL police traffic
radar or Laser frequency, i.e.,
“2244..115500” to confirm K band.
5. VOLTAGE METER Mode
Full Power-up text sequence.
Text Messages identify band
received. Between alerts, display
shows readout of your vehicle’s
battery voltage.
11 General Selectable Features
1. X Band (10.525 GHz)
ON or OFF
2. K Band (24.150 GHz)
ON or OFF
3. Super Wideband Ka
(33.4 – 36.0 GHz)
ON or OFF
4. AccuSweep™ON or OFF
5. AutoMute ON or OFF
6. Radar/Laser Digital
Voice Prompts ON or OFF
7. Safety Warning System™
ON/OFF
8. Safety Warning System™
Digital Voice ON or OFF
9. Audio/Visual Scroll Rate:
FAST or SLOW
10. Inverted Display Option
ON or OFF
11 . AutoScan™, “Highway”,
“City X”or “City ALL.”

33
Table of Contents
Profile of Features . . . . . . . . . . . . . . . . . . . . . . . . . 4
Getting Started . . . . . . . . . . . . . . . . . . . . . . . . . . . 5
kPower-Up Test Sequence/Start-Up Mode . . . . 5
kTutorial Mode . . . . . . . . . . . . . . . . . . . . . . . . . 7
kSet and Forget Memory . . . . . . . . . . . . . . . . . . 8
kReset to Factory Settings . . . . . . . . . . . . . . . . . 8
kDRK (Bright/Dim/Dark) Button . . . . . . . . . . . 8
kAUD (Auto-Mute/Volume Control) Button . . . 9
kCTY (City/Highway) Button . . . . . . . . . . . . . . 9
Selectable Features (North American Mode) . . . . . . . 11
kTravel Mode – What is it? . . . . . . . . . . . . . . . . 14
kEngaging Travel Mode . . . . . . . . . . . . . . . . . . . 14
kEntering Selectable Features . . . . . . . . . . . . . . 16
Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16
kGeneral Guidelines . . . . . . . . . . . . . . . . . . . . . . 16
Understanding Radar, Laser and SWS™. . . . . . . . . . 19
Interpretation of Alerts . . . . . . . . . . . . . . . . . . . . . 20
kRadar Alerts . . . . . . . . . . . . . . . . . . . . . . . . . . . 20
kInstant-On/Pulsed Radar Alert . . . . . . . . . . . . 22
kTypical False Alert (Radar) . . . . . . . . . . . . . . . . 23
kLaser Alerts . . . . . . . . . . . . . . . . . . . . . . . . . . . 23
kSafety Warning System®(SWS™) Alerts . . . . . . 24
Performance Verification . . . . . . . . . . . . . . . . . . . . 26
k
Conditions That Affect Radar Alerts . . . . . . . . 26
Conditions That Affect Laser Alerts . . . . . . . . 26
Troubleshooting . . . . . . . . . . . . . . . . . . . . . . . . . . . 27
Limited Warranty . . . . . . . . . . . . . . . . . . . . . . . . . . 28
Service . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29
k
Warranty Service . . . . . . . . . . . . . . . . . . . . . . . 29
Post Warranty Service . . . . . . . . . . . . . . . . . . . 30
Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30
k
k

Profile of Features
1. PWR (Power/Start-Up Mode) Button: pressing
and holding PWR will turn the unit on. Continuing
to press the PWR button will scroll through the five
start-up mode options: NNOORRMMAALL,,MMOODDSS
(Modifications), QQ--SSTTAARRTT(Quick Start), TTEECCHHMMOODDEE,,
VVOOLLTTAAGGEEMMEETTEERRMMOODDEEplus TTUUTTOORRIIAALLMMOODDEE.
2. Text Message Display:communicates all mode
selections (i.e. DDIIMM, DDAARRKK, CCIITTYY, HHIIGGHHWWAAYYand
AAUUTTOOMMUUTTEE)and confirms Radar band and signal
strength, presence of Laser and SWS™messages
received.
3. DRK (Bright/Dim/Dark) Button: provides bright,
dark and fully adjustable dim settings of the Text
Display for discreet night travel. Audio alerts are not
affected.
4. CTY (City/Highway/AutoScan) Button: choose
between Autoscan™, Highway, City X or City ALL
(X/K/Ka) filtration modes.
5. AUD (Auto-Mute/Volume Control) Button:
provides manual muting of all Radar and sws™alerts.
Pressing and holding the AUD button will change the
audio level.
6. Antenna Opening: Radar and sws™signals are
received by a patented diecast antenna with
integrated transition to microstrip mixer.
4
7
24
1
9
6
3
5
8

5
7. Laser Optical Sensors: collect Laser signals from in
front and behind.
8. Audio Alert Speaker: all audible alerts and Digital
Voice Messages are emitted from this location.
9. Power Jack: using the straight or coiled cord,
VECTOR 990 operates in any vehicle with a 13.8 volt DC
negative ground system (10.5 volt to 15.5 volt range) .
Getting Started
Power-Up Test Sequence/Start-Up Mode
Using the supplied straight or coiled power cord,
place the end with the “elbow” shaped jack into the
receptacle on the side of the detector; the opposite
end of the cord connects to the cigarette barrel. Plug
the cigarette barrel into your vehicle’s cigarette plug, or the
secondary receptacle if your vehicle is so equipped. Press
the PWR button to turn the unit ON. Depending upon the
Operating Mode selected, the power up test sequence and
confirmation of Radar/Laser/SWS™alerts will be relayed to
you as follows:
NNOORRMMAALL(Factory Pre-Set Mode)
A lengthy, power up test sequence that displays audio
and text messages for Laser, Ka, K, X and Safety
Warning System®(SWS™) followed by the status of
the General Selectable Features each time the unit is
turned on. When complete, unit is ready for
operation and will display Radar, Laser and SWS™
messages when signals are detected. Normal Mode
is recommended when first using your VECTOR 990.
MMOODDSS(Modifications Mode)
Presents audio and text messages for Laser, Ka, K, X
and Safety Warning System®(SWS™), followed by
ONLY those General Selectable Features which have
been modified by the user from their Factory pre-set
state each time unit is turned on. Unit is ready for
operation and will display Radar, Laser and SWS™
messages when signals are detected.
5
k
k
k

QQ--SSTTAARRTT(Quick-Start Mode)
Unit will bypass the power up test sequence and will
display the last selected traveling mode:“
AAuuttooSSccaann™
”
(factory default) “
HHiigghhwwaayy
”, “
CCiittyyXX
” or “
CCiittyy AALLLL”.
Q-Start is recommended when you are comfortable
with the detector and do not require a rundown of
sample messages. Unit is ready for operation and will
display Radar, Laser and SWS™messages when
signals are detected.
TTEECCHHMODE (Displays Frequency Received)
Presents audio and text messages followed by the
display of the ACTUAL frequency of the received
radar bandwidth and Laser. Unit is ready for
operation and will display Radar, Laser and SWS™
messages – including actual frequencies – when
signals are detected.
Sample alerts while operating in Tech Mode:
Laser Alert: “LLAASSEERR990000NNMM”
X Band Alert: “XXBBAANNDD” followed by “1100..552255”
K Band Alert: “KKBBAANNDD” followed by “2244..115500”
Ka Band Alert: “KKaaBBAANNDD” followed by any
frequency between 3333..44––3366..00GGHHzz.
VV--MMEETTEERR(Voltage Meter Mode)
Presents a continuous, digital readout of your
vehicle’s battery voltage (10.5 volt to 15.5 volt range) .
If voltage rises above 15.5, the display will flash
“HHIIVVOOLLTT” until the problem with your vehicle is
corrected. If voltage falls below 10.5 volts, display
will flash “LLOOWWVVOOLLTT” until the problem with your
vehicle is corrected.
6
Note: during continuous readout of your vehicle’s battery voltage, you’ll
notice the mode of operation you’re traveling will be illuminated in the
left hand corner of the display in abbreviated form:
Autoscan: AAssHighway: HHCity X: CCxxCity ALL: CCAA
k
k
k

7
Whichever Operating mode you select, VECTOR 990
will be in standby mode and ready to detect traffic
Radar, Laser and SWS™signals. The display will show
“
AAuuttooSSccaann™
” (factory pre-set which is suitable for ALL
driving conditions, unless you change this to “
HHiigghhwwaayy
”,
“
CCiittyyXX
”, or “
CCiittyy AALLLL” (see page 9).
TUTORIAL MODE
The Tutorial Mode allows you to become more
familiar with all audible and visual alerts. The
message “
TTUUTTOORRIIAALL
” appears in the display followed
by the audio and corresponding Text Message for
“
LLAASSEERR
” , “
KKaaAAUUDDIIOO
” , “
KKAAUUDDIIOO
” , “
XXAAUUDDIIOO
” , sample
Radar alert (K band signal ramping from weak to
strong) and “
SSAAFFEETTYYWWAARRNNIINNGGSSYYSSTTEEMMSSAAMMPPLLEEAALLEERRTTSS
” .
Three sample SWS™messages are then presented in
the display along with the corresponding
Digital Voice Messages:
Sample 1
“
AACCCCIIDDEENNTTAAHHEEAADD
”
Sample 2 “
HHIIGGHHWWAAYYWWOORRKKCCRREEWWAAHHEEAADD
”
Sample 3 “
PPOOLLIICCEEIINNPPUURRSSUUIITT
”
You can access the complete list of SWS
™
messages
by pressing the AUD button. “MMSSGG11”will appear in the
display once AUD is pressed. Pressing the AUD button
a second time will allow you to listen to the SWS
™
message while viewing it in the display. (to move
forward in the list, press the CTY button; to move
backward in the list, press the DRK button). Continue
the steps above to play all 60 SWS
™
messages.
To exit Tutorial Mode, press the PWR button and
your unit will be on and ready to receive signals.
7
k
Note: sample radar and SWS™messages are random.
Presentation of alerts will differ than what is printed based
on operating mode selected. Tutorial Mode will cycle
continuously until PWR is pressed to exit this mode.

Set and Forget Memory
Any time VECTOR 990 is turned off or unplugged
from the cigarette lighter socket, all feature settings
you have selected are retained in the unit’s memory.
Set and Forget Memory eliminates the need to reset
your preferred feature settings each time your unit is
turned off and then back on.
Reset to Factory Settings
You can reset your unit to factory settings (North
American Mode) for Start-Up mode, volume, DRK, AUD,
CTY and General Selectable Features. To reset, press
and hold the CTY button with the unit on until the
display shows “RREESSEETT“.Two“beeps” will sound and your
unit will cycle through the NNOORRMMAALLStart-Up Mode.
DRK (Bright/Dim/Dark) Button
The DRK button allows selection of a bright, fully
adjustable dim or dark mode. VECTOR 990 is
factory preset to full bright display. To engage dim
mode, press and hold the DRK button. The display
will cycle through various levels of dim illumination.
Release the button at your chosen level. To engage
dark mode, press the DRK button a second time.
A single “beep” coupled with the brief illumination
of “
DDAARRKK
” on the display confirms your selection.
You’ll notice an
“
AAss
”
(AutoScan™),
“
HH
”
(Highway
mode),
“
CCxx
”
(City mode) or
“
CCAA
”
(City ALL)
remains dim to confirm your unit is receiving power.
To return to a full bright setting, press the DRK
button a third time; two “beeps” confirm this
selection. Use of the DRK button does not affect
audio alerts.
Important—if you press the the DRK button and do not
receive audible confirmation, the audio level has been set
too low.
8
k
k
k

9
AUD (Auto-Mute/Volume Control) Button
Manual Muting of Audio Alerts
(Radar and SWS™)
Whether Auto-Mute is selected on or off in Selectable
Features, the audio alerts can be completely muted by
pressing the AUD button during an alert. The display will
briefly show “
QQUUIIEETT
” . No audible alert will be heard as
long as the signal is present. The unit will remain in manual
mute mode for approximately 12 seconds from the last
received alert.
Note—because Laser alerts are not lengthy or sustained,
muting is not required (see page 23)
Volume Control
Press and hold the AUD button to engage the
volume control; the volume will cycle high to low.
The audio level has 9 settings for VECTOR 990.
Release the AUD button when you have reached your
desired audio setting.
CTY (City/Highway) Button
The CTY button has four functions:
1. AutoScan™ Mode
2. Highway Mode
3. City X Filtration Mode
4. City X/K/Ka Filtration Mode
AutoScan™ Mode:
VECTOR 990 is factory shipped with AutoScan™
engaged. Autoscan™is designed to automatically
adjust sensitivity to X and K Band Radar whatever
your driving environment. Whether driving in densely
populated urban areas or “wide open” rural areas,
AutoScan™will automatically reject virtually all false
9
k
k
k
k
k

signals which are shared with traffic radar on X and K
Bands such as door openers and security systems.
AutoScan™is a “no-fuss” means of achieving
optimum signal selectivity.
Highway Mode:
Select Highway mode when traveling in rural or
highway environments for maximum X, K, Super
Wideband Ka sensitivity.
City X Mode:
Select City X mode when traveling in moderate city
conditions of travel, and some level of X band
filtration is required. Once engaged, weak X band
signals encountered will produce no audible alert
until the signal strength reaches a preset level.
However, visual alerts will be processed the instant
an X band signal is detected, keeping you quietly
informed. Since most “false” X band signals are
weak, the use of the CTY mode allows you to drive
out of their range before they reach the preset level
and trigger a full audio alert.
City All Mode (X, K, Super Wideband Ka):
This mode is ideal for use in areas where a high level
of microwave transmissions can cause falsing on all
three Radar bands. In City All mode, VECTOR 990
will provide an initial short alert coupled with visual
confirmation of the band detected and signal
strength in the display. No further audible alert is
provided until the signal strength reaches a preset
level. When no audio alert is provided, the visual
alert keeps you quietly informed.
Note: All CTY functions operate with ALL X,K and Ka
frequencies when VECTOR 990 International is
operating in Tr avelMode.
10
k
k
k

Selectable Features - North American Mode
There are a total of 16 Driver Selectable Features in North
American Mode (NNAAmmeerriiccaa)which may be selected
depending upon your driving environment and preference.
1. X Band (10.525 GHz) ON/OFF
2. K Band (24.150 GHz) ON/OFF
3. Super Wideband Ka (33.4 – 36.0 GHz)ON/OFF
4. AccuSweep™ (Ka Narrow detection) ON/OFF
5. AutoMute ON or OFF
6. Radar/Laser Digital Voice Prompts ON/OFF
7. Safety Warning System®ON/OFF
8. Safety Warning System®Digital VOICE or TONE
9. Audio/Visual Scroll Rate FAST or SLOW
10. Inver ted Display Option ON/OFF
11 . AutoScan™
(accessed using CTY Button)
12 . Normal Mode
(Note: 12-16 accessed using PWR Button)
13 . Modifications Mode
14 . Q -Start
15 .Tech Mode
16 .Voltage Meter Mode
Description of Selectable Features
Features 1-3
X/K/Super Wideband Ka Band ON or OFF
Select “
XXoonn//XXooffff
”
,,
“
KKoonn//KKooffff
” or
“
KKaaSSWWIIDDEEoonn//ooffff
” depending upon your driving
environment and selectivity requirements.
This mode is especially useful where falsing may occur
and disabling the offending band may be an option .
Factory setting is ON for all three bands.
Note:Super Wideband Ka is ON when the check mark
symbol is FLASHING, Super Wideband Ka is OFF when
the underscore line is flashing.
11
k

Feature 4 – AccuSweep™
AccuSweep™provides you the option of scanning just
a segment of the Super Wideband Ka bandwidth.
AccuSweep™accurately pinpoints the most prevalent
North American Ka radar frequencies in use, without
annoying harmonic falsing. Ideal for fast, accurate
Ka band detection.
Note: If you choose Super Wideband Ka band OFF and
AccuSweep™OFF, the next prompt will read: “NNOOKKaaoonn”.
This is a reminder that you have turned OFF all Ka band
detection. Move backward in the list (press DRK) to active
Super Wideband Ka or AccuSweep™.
Feature 5 – AutoMute On or Off
With “AAmmuutteeoonn”, VECTOR 990 will provide several
X, K or Super Wideband Ka audio alerts followed
by the Digital Voice announcement of the signal
detected. After the Digital Voice announcement, a
“clicking” tone keeps you quietly informed for as long
as the signal is present. This clicking becomes more
rapid as the strength of the Radar signal increases.
“AAmmuutteeoonn” enables you to conveniently monitor
extended encounters without having to manually
mute or adjust the volume setting.
With “AAmmuutteeooffff”, your unit will provide a continuous
series of X, K, Super Wideband Ka audio alerts and
Digital Voice announcements of the signal detected.
Digital Voice prompts are provided once after the
initial audio alert. This standard setting is often
preferred when background noise in a vehicle is loud.
Factory setting is “AAmmuutteeooffff”.
Note: because of its urgency, Laser alerts are not affected
by this mode.
12
k
k

Feature 6 – Radar/Laser Digital Voice Prompts
With “VVooiicceeoonn”, unit will provide Digital Voice
prompts followed by “beeps” when X/K/Ka and
Laser signals are detected. With “VVooiicceeooffff”, unit
will sound unique audio tones only. Factory setting
is “VVooiicceeoonn”.
Feature 7 – Safety Warning System®(SWS™)
(NAmerican Mode only)
With “SSWWSSoonn”, unit will provide a message when
signals from SWS™transmitters are detected.
Factory setting is “SSWWSSoonn”.
Feature 8 – Safety Warning System®Voice or Tone
(NAmerican Mode only)
When “SSWWSSvvooiiccee” is selected, unit will provide
Digital Voice announcements when SWS™transmitters
are detected. Factory setting is “SSWWSSvvooiiccee”. When
“SSWWSSttoonnee” is selected, Digital Voice is replaced by
tone/clicking only. Factory setting is “SSWWSSvvooiiccee”.
Feature 9 – Audio/Visual Scroll Rate
When “SSCCRRssllooww” is selected, unit will provide a slow
cycling of audio/visual messages. When “SSCCRRffaasstt” is
selected, unit will provide a fast cycling of
audio/visual messages. Factory setting is “SSCCRRssllooww”.
Feature 10– Inverted Display Feature
When selected, VECTOR 990 can be mounted upside
down to your vehicle’s headliner using the hook and
loop fastener; the display will remain normal reading.
Upside down mounting may allow for easier access
to the unit’s buttons.
Note: Inverted display is ON when the check mark symbol
is FLASHING; inverted display is OFF when the underscore
line is flashing.
13
k
k
k
k
k

Travel Mode – What is it?
VECTOR 990 International is designed to operate anywhere
you travel. Because different countries use different
frequencies to monitor traffic, BELTRONICS has designed
the ONLY detector capable of detecting ALL traffic radar
frequencies used worldwide.
All Radar bands, whether used in North America or Europe
fall under the X, K or Ka band classification. The difference
is the operating frequency, measured in Gigahertz, which the
X, K or Ka Band signal is transmitted. When in Travel Mode,
VECTOR 990
International will sound an X, K or Ka Digital
Voice Message or an X, K or Ka “tone” (whichever you have
chosen in Selectable Features) when Radar is encountered.
The Text Message Display will show the actual frequency
detected followed by the corresponding alarm –see samples
below:
99..99➡ XXBBaanndd(sample UK signal)
1100..552255➡XXBBaanndd(sample North American Signal)
Engaging Travel Mode (for International Travel)
VECTOR 990 International is factory preset for North American
Travel. For operation outside of North America, engage Tr avel
Mode. To engage Tr avelMode, with the unit ON, press and
hold the CTY button until the display reads: Tr avel.
Release the CTY Button.
With the unit set in Tr avelMode, the number of
Radar frequencies totals 10. To access these frequencies,
see Selectable Features, page 16. In addition, Tr avelMode
presents the actual frequency detected followed by the regular
alarm. Based on the alert pattern received (see page 20), you
can judge which frequencies in your areas of travel you know to
be “false” and which signals are true traffic radar.
14
k
k

This allows you to turn OFF any frequency which you know to
be generating false alerts. (Note: You can also turn off a frequency
if you know it is NOT used in your area of travel.)
For example, because other devices are shared with traffic
Radar (see Typical False Alerts, page 23), you may notice a
constant X band signal (9.9 GHz) alarming in a specific area
you know to be a false alert. By displaying the actual
frequency, you are then able to determine if you want to
turn that particular frequency OFF.
Tr avelMode has ALL 10 Radar frequencies engaged when
shipped from the factory. A flashing check mark and
horizontal line confirm frequency is ON; a flashing,
horizontal line confirms when frequency is OFF. Depending
upon the frequencies used in your area of travel, you can
turn any of the frequencies OFF.
Note: It is important to know what frequencies are used in your
area of travel. If you encounter excessive falsing on X, K or Ka
bands when operating your unit in Travel mode, you can engage
the City All (X, K, Super Wideband Ka) mode or turn the offending
Band or Bands off in Selectable Features. (see page 11). If excessive
falsing occurs specifically on Super Wideband Ka, select the specific
Ka Narrow frequency or frequencies used in your areas of travel.
VECTOR 990 International allows you to engage one, two or three
specific Ka narrow frequencies (33.8 GHz, 34.3 GHz, 34.7 GHz)
For information on frequencies used in Europe,
call 1-800-341-2288 (USA) or 1-800-268-3994 (CAN).
Note: Ku Band alerts are not supported with Digital Voice.
A unique audio tone confirms Ku band signal detection.
Selectable Features Travel Mode
The menu of Selectable Features while in Tr avelMode is the
SAME as in NAmerica mode with the following differences:
•10individual Radar frequencies appear which you can
turn ON or OFF, depending upon driving environment.
15
k

•SWS
™feature and SWS™Voice/Tone do not appear since
the SWS™feature is not available in Europe.
•AccuSweep™is replaced with 3 individual Ka Narrow
frequencies which you can choose ON or OFF, depending
upon driving environment.
Entering Selectable Features Mode
1. With the unit OFF, press and hold the PWR and CTY
buttons simultaneously. The word “FFEEAATTUURREESS” will appear
in the display, followed by the status of the first
Selectable Feature.
2. Press the CTY button to move to the next Selectable
Feature. To move backward in the list, press the DRK
button.
3. Press the AUD button to make your selection.
4. Press the PWR button to exit Selectable Features mode.
To confirm your unit is ready for operation, and what
mode of travel your unit is operating, the display will
read: “
AAuuttooSSccaann
”, “HHiigghhwwaayy” , “CCiittyyXX” or
CCiittyy AALLLL.
Installation
General Guidelines
Do not mount your unit directly behind windshield
wipers or mirrored sunscreens which block Radar and
Laser signals and substantially reduce warning range.
Unlike “after market” mirrored sun-screens, regular
tinted glass does not affect Radar reception. Radar
signals are also reflected by “heated windshields” known
as Instaclear®and ElectriClear®available as an option on
some vehicles. This type of windshield makes any dash,
visor or windshield mounted detector ineffective.
(If in doubt, check with an appropriate dealership to
see if this applies to your vehicle.)
16
k
k
Instaclear is a registered trademark of the Ford Motor Company.
ElectriClear is a registered Trademark of Libbey, Owens, Ford, and Delco-Remy.

To achieve optimum performance, regardless of which
mounting position you choose, follow the basic steps
on the following page.
1. Consider occupant safety when selecting a mounting
location. Choose a location where the unit will not be
hazardous in case of an accident.
2. For optimum detection, position your unit with a clear,
unobstructed view of the road from the front and rear.
3. Do not allow the unit to make contact with the
windshield. This will eliminate unnecessary vibration.
4. Avoid placing your unit in direct sunlight. During the
summer, interior temperatures of an enclosed vehicle can
sometimes reach temperatures that will cause premature
aging of the unit.
5. Your detector is not waterproof; exposure to water may
cause damage and your warranty will be void.
Dash Mounting
You can mount your unit to a level area of your vehicle’s
dash using the hook and loop fastener or the four,
non-skid dash mounting pads provided.
Windshield Mounting
1. Remove the mounting cover on the top of the
detector by pressing on the raised dots and pushing
outward.
2. Insert the “grooved” cover plate supplied until it locks
into place.
3. Clean the desired area of the windshield, and adhere the
windshield/visor bracket by pressing on the suction cups.
17
k
k

4. Slide the detector onto the mounting bracket until it
“locks” into place.
5. To adjust the angle of the
bracket, squeeze and hold the
circular “buttons” on the sides
of the bracket; this will allow
you to angle the bracket to
your windshield.
Note—some vehicles have a
plastic coating on the inside
of the windshield designed to
protect occupants in case of
an accident. Use of the
windshield bracket on this type of windshield can
permanently mark the surface. Check with your dealer if you
are unsure whether your vehicle is equipped with this type of
windshield.
Visor Mounting
1. Remove the two suction cups and follow steps
1, 2, 4 and 5.
2. Clip the detector to the edge of the sun visor nearest
the windshield.
Fuse Replacement
If the fuse has blown, remove the tip from the lighter
plug followed by the old fuse. Replace the fuse with a
1-amp, 3AG fuse. Defeating the fuse protection can
damage your unit or your vehicle’s electrical system
and will void your warranty.
Note—the tip is in two pieces; be careful not to lose either
piece or the spring inside the holder. (See diagram below).
18
k
k