GE JBS86 User manual

Write the model and serial
numbers here:
Model #_________________
Serial # _________________
You can find them on a label
behind the door or drawer.
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
OWNER’S MANUAL
RANGES
Electric Free-Standing
49-2000998 Rev. 1 11-21 GEA
SAFETY INFORMATION .......... 3
USING THE RANGE
Surface Units........................... 6
Cookware for Radiant Glass Cooktop. . . . . . 8
Double Oven Controls ................... 9
Special Features ........................10
Sabbath Mode..........................11
Oven Racks ............................12
Aluminum Foil and Oven Liners...........12
Cookware..............................12
Cooking Modes.........................13
Cooking Guide .........................14
Air Fry Cooking Guide...................16
CARE AND CLEANING
Cleaning the Range – Exterior ............17
Cleaning the Range – Interior ............18
Cleaning the Glass Cooktop ..............18
Oven Light............................20
Oven Door .............................21
TROUBLESHOOTING TIPS....... 22
LIMITED WARRANTY ............26
ACCESSORIES .................... 27
CONSUMER SUPPORT ........... 28
JBS86
30" Free-Standing Double Oven
GE is a trademark of the General Electric Company. Manufactured under trademark license.

249-2000998 Rev. 1
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.

49-2000998 Rev. 13
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
ANTI-TIP DEVICE
To reduce the risk of tipping the range,
the range must be secured by a properly
installed anti-tip bracket. See installation
instructions shipped with the bracket for
complete details before attempting to install.
For Free-Standing and Slide-In Ranges
To check if the bracket is installed and
engaged properly, look underneath the
range to see that the rear leveling leg is
engaged in the bracket. On some models, the storage drawer or kick panel
can be removed for easy inspection. If visual inspection is not possible,
slide the range forward, confirm the anti-tip bracket is securely attached to
the floor or wall, and slide the range back so the rear leveling leg is under
the anti-tip bracket.
If the range is pulled from the wall for any reason, always repeat this
procedure to verify the range is properly secured by the anti-tip bracket.
Never completely remove the leveling legs or the range will not be secured
to the anti-tip device properly.
WARNING Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
• A child or adult can tip the range and be killed.
• Install the anti-tip bracket to the wall or floor.
•
Engage the range to the anti-tip bracket by sliding the
range back such that the foot is engaged.
• Re-engage the anti-tip bracket if the range is moved.
• Failure to do so can result in death or serious burns
to children or adults.
Tip-Over Hazard
WARNING
Anti-Tip
Bracket
Leveling Leg
Free-Standing and Slide-In Ranges
WARNING GENERAL SAFETY INSTRUCTIONS
■ Usethisapplianceonlyforitsintendedpurposeas
described in this Owner’s Manual.
■ Haveyourrangeinstalledandproperlygroundedby
a qualified installer in accordance with the provided
installation instructions.
■ Anyadjustmentandserviceshouldbeperformed
only by a qualified installer or service technician.
Do not attempt to repair or replace any part of your
range unless it is specifically recommended in this
manual.
■ Beforeperforminganyservice,unplugtherange
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
■ Donotleavechildrenalone—childrenshouldnot
be left alone or unattended in an area where an
appliance is in use. They should never be allowed
to climb, sit or stand on any part of the appliance.
■ CAUTION Do not store items of interest to
children above a range or on the backguard of a
range—childrenclimbingontherangetoreach
items could be seriously injured.
■ Useonlydrypotholders—moistordamppot
holders on hot surfaces may result in burns from
steam. Do not let pot holders touch hot surface
units or heating elements. Do not use a towel or
other bulky cloth in place of pot holders.
■ Neveruseyourapplianceforwarmingorheating
the room.
■ Besureallpackingmaterialsareremovedfromthe
range before operating to prevent ignition of these
materials.
■ Donotuseanytypeoffoilorlinertocoverthe
oven bottom or anywhere in the oven, except as
described in this manual. Oven liners can trap heat
or melt, resulting in damage to the product and risk
of shock, smoke or fire.
■ Ifaheatingelement,eitheronasurfaceunitorin
the oven, develops a glowing spot or shows other
signs of damage, do not use that area of the range.
A glowing spot indicates the surface unit may fail
and present a potential burn, fire, or shock hazard.
Turn the heating element off immediately and have
it replaced by a qualified service technician.

449-2000998 Rev. 1
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
Failure to do so may result in fire or personal injury.
■ Donotstoreoruseflammablematerialsinanoven
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
■ Neverwearloose-fittingorhanginggarmentswhile
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
■ Donotletcookinggreaseorotherflammable
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
■ Donotusewaterongreasefires.Neverpickup
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
tray.Useamulti-purposedrychemicalorfoam-type
fire extinguisher.
■ Ifthereisafireintheovenduringbaking,smother
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
■ Ifthereisafireintheovenduringself-clean,turn
the oven off and wait for the fire to go out. Do not
force the door open. Introduction of fresh air at self-
clean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
WARNING COOKTOP SAFETY INSTRUCTIONS
■ Never leave the surface units unattended. Boilovers
cause smoking and greasy spillovers that may
ignite.
■ Neverleaveoilunattendedwhilefrying.Ifallowed
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
cabinets.Useadeepfatthermometerwhenever
possible to monitor oil temperature.
■ Toavoidoilspilloverandfire,useaminimum
amount of oil when shallow pan-frying and avoid
cooking frozen foods with excessive amounts of ice.
■ Useproperpansize—selectcookwarehaving
flat bottoms large enough to cover the surface
heating element. The use of undersized cookware
will expose a portion of the surface unit to direct
contact and may result in ignition of clothing. Proper
relationship of cookware to surface unit will also
improve efficiency.
■ Whenusingglass/ceramiccookware,makesureit
is suitable for cooktop service; others may break
because of sudden change in temperature.
WARNING GENERAL SAFETY INSTRUCTIONS (Cont.)
■ Donottouchthesurfaceunits,theheatingelements
or the interior surface of the oven. These surfaces
may be hot enough to burn even though they are
dark in color. During and after use, do not touch,
or let clothing or other flammable materials contact
the surface units, areas nearby the surface units or
any interior area of the oven; allow sufficient time
for cooling first. Other surfaces of the appliance
may become hot enough to cause burns. Potentially
hot surfaces include the cooktop, areas facing the
cooktop, oven vent opening, surfaces near the
opening and crevices around the oven door.
■ Donotheatunopenedfoodcontainers.Pressure
could build up and the container could burst,
causing an injury.
■ Avoidscratchingorimpactingglassdoors,cook
tops or control panels. Doing so may lead to glass
breakage. Do not cook on a product with broken
glass. Shock, fire or cuts may occur. Contact a
qualified technician immediately.
■ Cookfoodthoroughlytohelpprotectagainst
foodborne illness. Minimum safe food temperature
recommendations can be found at IsItDoneYet.gov
and fsis.usda.gov.Useafoodthermometertotake
food temperatures and check several locations.
■
Do not allow anyone to climb, stand, or hang on the
oven door, drawer, or cooktop. They could damage
the range or tip it over, causing severe injury or death.

49-2000998 Rev. 15
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING COOKTOP SAFETY INSTRUCTIONS
■ Tominimizethepossibilityofburns,ignitionof
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby surface units.
■ Whenpreparingflamingfoodsunderahood,turn
the fan on.
■ Ifpowerislosttoanelectriccooktopwhileasurface
unit is ON, the surface unit will turn back on as soon
as power is restored.
■ Intheeventofpowerloss,failuretoturnallsurface
unit knobs to the OFF position may result in ignition
of items on or near the cooktop, leading to serious
injury or death.
■ Donotcookonabrokencooktop.Ifglasscooktop
should break, cleaning solutions and spillovers
may penetrate the broken cooktop and create a
risk of electric shock. Contact a qualified technician
immediately.
■ Avoidscratchingtheglasscooktop.Thecooktop
can be scratched with items such as knives, sharp
instruments, rings or other jewelry, and rivets on
clothing.
■ Donotplaceorstoreitemsthatcanmeltorcatch
fire on the glass cooktop, even when it is not being
used. If the cooktop is inadvertently turned on, they
may ignite. Heat from the cooktop or oven vent after
it is turned off may cause them to ignite also.
■ Useceramiccooktopcleanerandnon-scratch
cleaning pad to clean the cooktop. Wait until the
cooktop cools and the indicator light goes out
before cleaning. A wet sponge or cloth on a hot
surface can cause steam burns. Some cleaners can
produce noxious fumes if applied to a hot surface.
NOTE: Sugar spills are an exception. They should
be scraped off while still hot using an oven mitt
and a scraper. See the Cleaning the glass cooktop
section for detailed instructions.
WARNING OVEN SAFETY INSTRUCTIONS
■ Keeptheovenventunobstructed.
■ Standawayfromtherangewhenopeningtheoven
door. Hot air or steam which escapes can cause
burnstohands,faceand/oreyes.
■ Placeovenracksindesiredlocationwhileovenis
cool. If rack must be moved while oven is hot, do not
let pot holder contact hot heating element in oven.
■ Neverplacecookingutensils,pizzaorbakingstones,
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.
■ Donotleaveitemsonthecooktopneartheoven
vent. Items may overheat resulting in a risk of fire or
burns.
■ Donotleaveitemssuchaspaper,cookingutensils
or food in the oven when not in use. Items stored in
an oven can ignite.
WARNING RADIANT COOKTOP SAFETY INSTRUCTIONS
Usecarewhentouchingthecooktop.Theglasssurfaceofthecooktopwillretainheatafterthecontrolshave
been turned off. Clean cooktop With Caution – If a wet sponge or cloth is used to wipe spills on a hot cooking
area, be careful to avoid steam burn. Some cleaners can produce noxious fumes if applied to a hot surface.
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film with
your fingers and slowly peel it from the appliance surface.
Do not use any sharp items to remove the film. Remove all
of the film before using the appliance for the first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
Consider recycling options for your appliance packaging
material.
PROPER DISPOSAL OF YOUR APPLIANCE
Dispose of or recycle your appliance in accordance with Federal and Local Regulations. Contact your local
authorities for the environmentally safe disposal or recycling of your appliance.

649-2000998 Rev. 1
WARNING FIRE HAZARD: Never leave the range unattended with the cooktop on medium or high settings.
Keepflammableitemsawayfromthecooktop.Turnoffallcontrolswhendonecooking.Failureto
follow these instructions can result in fire, serious injury or death.
Surface Units
Throughout this manual, features and appearance may vary from your model.
How to Set
Push the knob in and turn in either direction to the
setting you want.
A surface ON indicator light will glow when any surface
unit is on
For glass cooktop surfaces:
A HOT COOKTOP indicator light will:
■ comeonwhentheunitishottothetouch.
■ stayonevenaftertheunitisturnedoff.
■ stayonuntiltheunitiscooledto
approximately 150°F.
Dual and Triple Surface Units and Control Knobs
The surface unit has 2 or 3 cooking sizes to select from so you can match the size of the unit to the size of the
cookware you are using.
At both OFF and HI the control clicks into
position. You may hear slight clicking
sounds during cooking, indicating the
control is maintaining your desired setting.
Be sure you turn the control knob to OFF
when you finish cooking.
Models with a Dual-Ring
surface element only
Melt setting will melt chocolate
or butter.
Using the Warming Zone
WARNING FOOD POISON HAZARD: Bacteria may grow in food at temperatures below 140°F.
■ Alwaysstartwithhotfood.Donotusewarmsettingtoheatcoldfood.
■ Donotusewarmsettingformorethan2hours.
The WARMING ZONE, located in the back center of
the glass surface, will keep hot, cooked food at serving
temperature. Always start with hot food. Do not use to
heat cold food. Placing uncooked or cold food on the
WARMING ZONE could result in foodborne illness.
Turn the control knob to the ON position.
For best results, all foods on the WARMING ZONE
should be covered with a lid or aluminum foil. When
warming pastries or breads, the cover should be vented
to allow moisture to escape.
The initial temperature, type and amount of food, type of
pan, and the time held will affect the quality of the food.
Always use pot holders or oven
mitts when removing food from the
WARMING ZONE, since cookware
and plates will be hot.
NOTE: The surface warmer will
not glow red like the cooking
elements.
USING THE RANGE:SurfaceUnits

49-2000998 Rev. 17
Home Canning Tips
Be sure the canner is centered over the surface unit.
Make sure the canner is flat on the bottom.
To prevent burns from steam or heat, use caution when
canning.
Userecipesandproceduresfromreputablesources.
These are available from manufacturers such as Ball®
andKerr®and the Department of Agriculture Extension
Service.
Flat-bottomedcannersarerecommended.Useofwater
bath canners with rippled bottoms may extend the time
required to bring the water to a boil.
Temperature Limiter on Radiant Glass Cooktops
Every radiant surface unit has a temperature limiter.
The temperature limiter protects the glass cooktop from
getting too hot.
The temperature limiter may cycle the surface units off
for a time if:
■ thepanboilsdry.
■ thepanbottomisnotflat.
■ thepanisoff-center.
■ thereisnopanontheunit.
For Models With a Radiant Glass Cooktop
The radiant cooktop features heating units beneath a
smooth glass surface.
NOTE: A slight odor is normal when a new cooktop is
used for the first time. It is caused by the heating of new
parts and insulating materials and will disappear in a
short time.
NOTE: On models with light-colored glass cooktops, it is
normal for the cooking zones to change color when hot
or cooling down. This is temporary and will disappear as
the glass cools to room temperature.
The surface unit will cycle on and off to maintain your
selected control setting.
It is safe to place hot cookware on the glass surface
even when the cooktop is cool.
Even after the surface units are turned off, the glass
cooktop retains enough heat to continue cooking. To
avoid overcooking, remove pans from the surface units
when the food is cooked. Avoid placing anything on the
surface unit until it has cooled completely.
■ Waterstains(mineraldeposits)areremovableusing
the cleaning cream or full-strength white vinegar.
■ Useofwindowcleanermayleaveaniridescentfilmon
the cooktop. The cleaning cream will remove this film.
■ Don’tstoreheavyitemsabovethecooktop.Ifthey
drop onto the cooktop, they can cause damage.
■ Donotusethesurfaceasacuttingboard.
USING THE RANGE:SurfaceUnits
Surface Units
Never cook directly on the glass.
Always use cookware.
Always place the pan in the center of the
surface unit you are cooking on.
Do not slide cookware across the cooktop because
itcanscratchtheglass—theglassisscratch-
resistant, not scratch proof.

849-2000998 Rev. 1
Cookware for Radiant Glass Cooktop
USING THE RANGE: Cookware for Radiant Glass Cooktop
The following information will help you choose cookware which will give good performance on glass cooktops.
NOTE: Follow all cookware manufacturer’s recommendations when using any type of cookware on the ceramic cooktop.
Recommended
Stainless Steel
Aluminum:
heavy weight recommended
Good conductivity. Aluminum residues
sometimes appear as scratches on the
cooktop but can be removed if cleaned
immediately. Because of its low melting
point, thin weight aluminum should not
be used.
Copper Bottom:
Copper may leave residues which can
appear as scratches. The residues can
be removed, as long as the cooktop
is cleaned immediately. However, do
not let these pots boil dry. Overheated
metal can bond to glass cooktops. An
overheated copper bottom pot will leave
a residue that will permanently stain the
cooktop if not removed immediately.
Enamel (painted) on Cast Iron:
recommended if bottom of pan is coated
Avoid/Not Recommended
Enamel (painted) on Steel:
Heating empty pans can cause
permanent damage to cooktop glass.
The enamel can melt and bond to the
ceramic cooktop.
Glass-ceramic:
Poor performance. Will scratch the
surface.
Stoneware:
Poor performance. May scratch the
surface.
Cast Iron:
notrecommended—unlessdesigned
specifically for glass cooktops
Poor conductivity and slow to absorb
heat. Will scratch the cooktop surface.
Check pans for flat bottoms by
using a straight edge.
Pans with rounded, curved,
ridged or warped bottoms are
not recommended.
For Best Results
■ Placeonlydrypansonthesurfaceelements.Donot
place lids on the surface elements, particularly wet lids.
Wet pans and lids may stick to the surface when cool.
■ Donotusewoksthathavesupportrings.Thistypeof
wok will not heat on glass surface elements.
■ Werecommendthatyouuseonlyaflat-bottomed
wok. They are available at your local retail store. The
bottom of the wok should have the same diameter as
the surface element to ensure proper contact.
■ Somespecialcookingproceduresrequirespecific
cookware such as pressure cookers or deep-fat
fryers. All cookware must have flat bottoms and be
the correct size.
Do not place wet pans on the glass cooktop.
Do not use woks with support rings on the glass cooktop.
Useflat-bottomedwoksontheglasscooktop.

49-2000998 Rev. 19
1. Upper Oven and Lower Oven: Designates
which oven the controls will operate.
2. Convection Cooking Modes: Convection
cooking modes use increased air circulation
to improve performance. The type of benefit
depends on the mode. Your oven has the following
convection cooking modes: Convection Bake and
Convection Roast. See the Cooking Modes section
for more information.
3. Traditional Cooking Modes: Your oven has
the following traditional cooking modes: Bake, Broil
Hi/LoandWarm.SeetheCookingModessection
for more information.
4. Steam Clean: See the Cleaning the Oven
section for important information about using this
mode.
5. Start: Must be pressed to start any cooking,
cleaning, or timed function.
6. Cancel/Off: Cancels ALL oven operations except
the clock and timer.
7. Set Clock: Sets the oven clock time. Press
andholdfor3seconds.Usethenumberpadsto
program the clock. Press Start to save the time.
8. Timer: Works as a countdown timer. Press the
Timer pad and the number pads to program the
time in hours and minutes. Press the Start pad.
If the oven is on, it will not turn off when the timer
countdown is complete. To turn the timer off press
the Timer pad.
9. Delay Time: Delays when the oven will turn
on.Usethistosetatimewhenyouwanttheoven
to start. Press the Delay Time pad and use the
number pads to program the time of day for the
oven to turn on then press Start. Press the desired
cooking mode and temperature then press Start.
A Cook Time may also be programmed if desired.
Follow the directions under Cook Time for setting
this feature. This can only be used with Bake,
Convection Bake, Convection Roast and Self-Clean.
NOTE: When using the Delay Time feature, foods
thatspoileasily—suchasmilk,eggs,fish,stuffings,
poultryandpork—shouldnotbeallowedtositfor
more than 1 hour before or after cooking. Room
temperature promotes the growth of harmful bacteria.
Be sure that the oven light is off because heat from
the bulb will speed harmful bacteria growth.
10. Cook Time: Counts down cooking time and turns
off the oven when the cooking time is complete.
Press the Cook Time pad, use the number pads
to program a cooking time in hours and minutes,
then press Start. This can only be used with Bake,
Convection Bake, and Convection Roast.
11. Oven Light(s): Turnstheovenlight(s)onoroff
in both ovens. Note that lights in both ovens will not
turn on if the door is opened while the other oven is
in a clean mode.
12. Lock Controls: Locks out the control so that
pressing the pads does not activate the controls.
Press and hold the Lock Controls pad for three
seconds to lock or unlock the control. Cancel/Off is
always active, even when the control is locked.
13. Air Fry (on some models): Air Fry is a special,
no-preheat, cooking mode that is designed to produce
foods with a crispier exterior than traditional oven
cooking. The Air Fry mode is intended for single rack
cooking only
USING THE RANGE: Double Oven Controls
Double Oven Controls
1 5 5 18
2
3
4 6 6
3
10 10 131112
9 74

10 49-2000998 Rev. 1
USING THE RANGE: Special Features
Special Features
There are several different special features on your range.
■ ToentertheSpecialFeaturesmenu,presstheUpper Oven Bake and Broil pads at the same time and hold for
three seconds. "OFFSEt" will appear in the display.
■ ScrollthroughSpecialFeaturesmenuusingthe8pad for down and the 3pad for up.
■ Toselectafeaturetochange,ortoconfirmachange,pressthe0pad.
■ TocancelachangeandreturntotheSpecialFeaturesmenu,pressthe6pad. To exit the Special Features
menu, press the 6pad again.
Adjust the Oven Temperature (OFFSEt)
This feature allows the oven baking and convection
baking temperature to be adjusted up to 35ºF hotter
ordownto35ºFcooler.Usethisfeatureifyoubelieve
your oven temperature is too hot or too cold and wish to
change it. This adjustment affects Bake and Convection
Bake modes. No other cooking modes are affected.
Usingthenumberpadstonavigateasdescribedabove,
select "OFFSEt". A number between positive and
negative35willdisplay.Usethe8or 3pads to increase
or decrease the offset value. Save and confirm by
pressing the 0pad.
End of Timer Signals (End tonE)
This is the tone that signals the end of a timer. The tone
canbecontinuous(ConbEEP)oronerepeatingbeep
(bEEP).Acontinuoussettingwillcontinuetosounda
tone until a button on the control is pressed.
Fahrenheit or Celsius Temperature
Display (dEg Unit)
The oven control is set to use Fahrenheit temperatures
(F),butyoucanchangeittouseCelsiustemperatures(C).
Clock Configuration (Cloc cFg)
This feature specifies how the time of day will be
displayed. You can select a standard 12-hour clock
(12H)or24-hourmilitarytime(24H).
Clock Display (Cloc diSP)
This feature specifies whether the clock appears in the
display. It may be On or Off.
Auto Recipe Conversion (Auto rEciPE)
When using Convection Bake cooking, Auto Recipe
Conversion will automatically convert the regular baking
temperatures entered to convection bake cooking
temperatures when turned on. Note that this option does
not convert convection bake cooking times, it only converts
temperatures. This feature may be turned On or Off.
Sound Volume (Sound)
This feature allows the oven tone volume to be adjusted
betweenhigh(Hi),medium(Reg),low(lo),andoff(Off).
The control will sound the oven tone at the new volume
level each time the sound level is changed.
12-hour Shutoff (2H ShutoFF)
This feature shuts the oven down after 12 hours of
continuous operation. It may be enabled or disabled.

49-2000998 Rev. 111
USING THE RANGE: Sabbath Mode
Sabbath Mode
TheSabbathmodefeaturecomplieswithstandardssetforthbyStarK.Someofthesestandardsthatwillbenoticed
by the consumer include the disabling of tones, disabling of oven lights, and delays of about 30 seconds to one
minute on display changes. Only continuous baking or timed baking is allowed in the Sabbath mode. Cooking in the
Sabbath mode is a two-step process, first the Sabbath mode must be set and then the bake mode must be set.
Setting the Sabbath Mode
1. Press the Upper Oven Bake and Broil pads at the
same time and hold until the special features menu is
displayed.
2. Usethe3or 8number pads to scroll through the
special features until “SAbbAth” is displayed and
then press 0. After 0 is pressed, the word OFF will be
displayed on the control.
3. Usethe3or 8number pads to scroll through the
options until “On” is shown in the display, then press
the 0number pad to save the setting. Sabbath
reappears after pressing 0. Press 6to exit the Special
Features menu. A single bracket “]” will appear in the
display indicating that the Sabbath mode is set. The
clock will not be displayed. Continuous bake or timed
bake can now be programmed.
NOTE: When you place the control into Sabbath
mode, both ovens are placed into Sabbath mode
and each oven will have a single bracket “]” in the
display. Each oven can be programmed to a different
temperature and each oven must be programmed
separately.
Starting a Continuous Bake
1. Press the Upper Oven Bake pad.
2. If the desired temperature is 350F, press Start. If
a different cooking temperature is desired, use the
1through 5number pads or Timer pad to select a
preset cooking temperature, then press Start. Refer
to the graphic below to determine which pad sets the
desired cooking temperature.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking.
Adjusting the Temperature
1. Press Upper Oven Bake, use the 1through 5
number pads and the Timer pad to select a different
preset cooking temperature, and press Start.
2. Since no feedback is given during temperature
change, an oven thermometer can be used to confirm
temperature changes.
Starting a Timed Bake
1. Press the Upper Oven Bake pad.
2. If the desired temperature is 350°F, use the 6
through 0number pads or the Lock Control pad to
select a cooking time. If a cooking temperature other
than 350°F is desired, use the 1through 5number
pads or the Timer pad to select a preset cooking
temperature, then select the cooking time. Refer to
the graphic on this page to determine which pad sets
the desired cooking temperature and cooking time.
3. Press Start.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking. When the cook
time expires, the display will change back to a single
bracket “]” indicating that the oven is no longer baking.
No tone will sound when the cook time is complete.
Exit the Sabbath Mode
Exiting the Sabbath mode should be done after the
Sabbath is over.
1. Press Cancel/Off to end any bake mode that may be
running.
2. Press Upper Oven Bake and Broil pads at the same
time and hold until the Special Features menu is
displayed.
3. Usethe3or 8number pads to scroll through the
special features until “SAbbAth” is displayed, then
press 0. After 0 is pressed, the word ON will be
displayed on the control.
4. Usethe3or 8number pads to scroll through the
options until “OFF” is displayed and press 0to save
the setting. Sabbath reappears after pressing 0.
Press the 6number pad to exit the Special Features
menu.
Sabbath Mode Power Outage Note
If a power outage occurs while the oven is in Sabbath
Mode, the unit will return to Sabbath Mode when power
is restored, however the oven will return to the off state
even if it was in the middle of a bake cycle when the
power outage occurred.
1 = 170° F, 2 = 200° F, 3 = 250° F, 4 = 300° F, 5 = 325° F, Timer = 400° F
6 = 2 hours, 7 = 2.5 hours, 8 = 3 hours, 9 = 3.5 hours,
0 = 4 hours, Lock Controls = 6 hours
Temperature(°F) 400
Time(hours) 6h
170
2h
200
2.5h
250
3h
300
3.5h
325
4h

12 49-2000998 Rev. 1
The number of rack positions may vary by model.
USING THE RANGE:OvenRacks/
Aluminum Foil and Oven Liners /Cookware
Oven Racks
Cookware
Cookware Guidelines
The material, finish, and size of cookware affect baking
performance.
Dark, coated and dull pans absorb heat more readily
than light, shiny pans. Pans that absorb heat more
readily can result in a browner, crisper, and thicker crust.
If using dark and coated cookware check food earlier
than minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
oven temperature by 25º F next time.
Shiny pans can produce more evenly cooked baked
goods such as cakes and cookies.
Glass and ceramic pans heat slowly but retain heat well.
These types of pans work well for dishes such as pies
and custards.
Air insulated pans heat slowly and can reduce bottom
browning.
Keepcookwarecleantopromoteevenheating.
CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foil may be used to catch spills by placing a sheet on a lower rack, several inches below the food. Do not use more
foilthannecessaryandneverentirelycoveranovenrackwithaluminumfoil.Keepfoilatleast1-1/2”fromovenwalls
to prevent poor heat circulation.
Aluminum Foil and Oven Liners
Recommended rack positions for various types of
foods are provided in the Cooking Guide. Adjusting
rack position is one way to impact cooking results. For
example, if you would prefer darker tops on cakes,
muffins, or cookies, try moving food one rack position
higher. If you find foods are too brown on top try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is at least 1½" between pans to allow
sufficient space for air to flow.
YourOvenmayhaveextensionracksand/ortraditional
flat racks.
To avoid possible burns, place the racks in the desired
position before you turn the oven on.

49-2000998 Rev. 113
USING THE RANGE: Cooking Modes
Cooking Modes
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Cooking Guide section for recommendations for specific foods. Remember, your new oven may perform
differently than the oven it is replacing.
Baking and Roasting Modes
Select a mode for baking and roasting based on the
type and quantity of food you are preparing. When
preparing baked goods such as cakes, cookies, and
pastries always preheat the oven first. Follow recipe
recommendations for food placement. If no guidelines
are provided, center food in the oven.
Bake
The bake mode is intended for single rack cooking. This
mode uses heat primarily from the lower element but
also from the upper element to cook food. To use this
mode press the Bake pad, enter a temperature, and
then press Start. Preheating is generally recommended
when using this mode.
Convection Bake Multi Rack
The Convection Bake Multi Rack mode is intended for
baking on multiple racks at the same time. This mode
uses heat primarily from the rear element, when available,
but also heat from the upper and lower elements, along
with air movement from the convection fan to enhance
cooking evenness. Your oven is equipped with Auto
Recipe Conversion, so it is not necessary to convert the
temperature when using this mode. Baking time might
be slightly longer for multiple racks than what would be
expected for a single rack. To use this mode press the
Convection Bake pad, enter a temperature, and then
press Start. Always preheat when using this mode.
Convection Roast
The Convection Roast mode is intended for roasting
whole cuts of meat on a single rack. This mode uses
heat from the lower, upper, and rear elements, when
available, along with air movement from the convection
fan to improve browning and reduce cooking time. It is not
necessary to convert temperature. Check food earlier than
the recipe suggested time when using this mode or use
a meat probe. To use this mode press the Convection
Roast pad, enter a temperature, and then press Start. It
is not necessary to preheat when using this mode.
Broiling Modes
Always broil with the oven door closed. Monitor food
closelywhilebroiling.Usecautionwhenbroiling;placing
food closer to the broil element increases smoking,
spattering, and the possibility of fats igniting. It is not
necessary to preheat when using the Broil modes.
Broil Hi
The Broil Hi mode uses intense heat from the upper
elementtosearfoods.UseBroilHiforthinnercuts
ofmeatand/orwhenyouwouldliketohaveaseared
surface and rare interior. To use this mode press the
Broil pad once and then press Start.
Broil Lo
The Broil Lo mode uses less intense heat from the upper
element to cook food thoroughly while also browning
thesurface.UseBroilLoforthickercutsofmeatand/or
foods that you would like cooked all the way through. To
use this mode press the Broil pad twice and then press
Start.
Warm
Warm mode is designed to keep hot food hot, it is not
intended to heat cold food. To use this mode, press the
Warm pad then press Start. Preheating is not required.
Cover foods that need to remain moist and do not cover
foods that should be crisp. It is recommended, for food
quality, that food not be kept warm for more than 2 hours.
Pre-Heat
Proper preheating ensures that the oven is hot enough
tobeginbaking.Improperpreheating(thatis,cooking
intheoventhathasnotcomeuptosettemperature)
can negatively affect cooking. Depending on the recipe
recommendations, the temperature of your foods when
they go into the oven may determine your final baking
time and baking results; if you put your food, such as
biscuits or breads, in during Pre-heat, they may over
brown on top or burn.
IMPORTANT: The more items to be heated in the oven
duringpreheat(thisincludesmultipleracks,baking
stones,etc.)willaffectthelengthofyourpre-heattime.
Always begin baking after the pre-heat signal. The signal
will be a beep, indicaotr light or chime. This lets you
know your oven is at your needed baking temperature.
For best results, turn the oven On before you begin your
prep work.

14 49-2000998 Rev. 1
Oven Cooking Guide
FOOD TYPE
RECOMMENDED
MODE(S)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer cakes, sheet cakes, bundt cakes,
muffins, quick breads on a Single Rack Bake 4 Useshinycookware.
Layer cakes* on Multiple Racks Bake
Convection Bake 3 and 5 Ensure adequate airflow
(seeillustrationonnextpage).
Chiffoncakes(angelfood) Bake 1 Useshinycookware.
Cookies, biscuits, scones on a Single Rack Bake 4 Useshinycookware.
Cookies, biscuits, scones on Multiple Racks Convection Bake 3 and 5
2, 4 and 6 Ensure adequate airflow.
Beef & Pork
Hamburgers Broil Hi 6
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling. For best
performance center food below the broil heating element.
Steaks & Chops Broil Hi 6
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling. For best
performance center food below the broil heating element.
Roasts Bake
Convection Roast 3 or 4 Usealowsidedpansuchasabroilpan.
Preheating is not necessary.
Poultry
Whole chicken Bake
Convection Roast 3 or 4 Usealowsidedpansuchasabroilpan.
Bone-in chicken breasts, legs, thighs
Broil Hi 2
If breaded or coated in sauce avoid Broil Hi modes. Broil
skin side down first. Watch food closely when broiling. For
best performance when broiling, center food below the broil
heating element.
Broil Lo
Bake 2 or 3
Boneless chicken breasts Broil Lo
Bake 2 or 3
Movefooddownformoredoneness/lesssearingandupfor
greatersearing/browningwhenbroiling.Forbestperformance
when broiling, center food below the broil heating element.
Whole turkey Bake
Convection Roast 1 or 2 Usealowsidedpansuchasabroilpan.
Turkey Breast Bake
Convection Roast 2 or 3 Usealowsidedpansuchasabroilpan.
Fish Broil Lo 6(1/2inchthickorless)
5(>1/2inch)
Watch food closely when broiling. For best performance center
food below the broil heating element.
Casseroles Bake 3 or 4
Frozen Convenience Foods
Pizza, potato products, chicken nuggets,
appetizers on a Single Rack Bake 3 or 4 Useshinycookware.
Pizza, potato products, chicken nuggets,
appetizers on Multiple Racks Convection Bake 3 and 5 Useshinycookware.
Lower Oven for Double Oven Models
USING THE RANGE: Oven Cooking Guide
Rack position for Traditional
Bake, cakes in front of rack 3
and back of rack 5
Rack position for Convection
Bake, cakes in back of rack 3
and front of rack 5
*When baking four cake layers at a time with traditional
bake, use racks 3 and 5.
*When baking four cake layers at a time with convection
bake, use racks 2 and 5.
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov. Make sure to use a food thermometer
to take food temperatures.

49-2000998 Rev. 115
USING THE RANGE: Cooking Guide
FOOD TYPE
RECOMMENDED
MODE(S)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer cakes, sheet cakes, muffins,
baked on Single Rack Bake 1 Useshinycookware.
Cookies, biscuits, scones on a Single
Rack Bake 1 Useshinycookware.
Beef & Pork
Hamburgers Broil Hi 1
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling. For best
performance center food below the broil heating element.
Steaks & Chops Broil Hi 1
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling. For best
performance center food below the broil heating element.
Poultry
Bone-in chicken breasts, legs, thighs Broil Lo
Bake 1
Broil skin side down first. Watch food closely when broiling.
For best performance when broiling, center food below the
broil heating element.
Boneless chicken breasts Broil Lo
Bake 1For best performance when broiling, center food below the
broil heating element.
Fish Broil Lo 1 Watch food closely when broiling. For best performance
center food below the broil heating element.
Frozen Convenience Foods
Pizza, potato products, chicken
nuggets, appetizers on a Single Rack Bake 1 Useshinycookware.
Upper Oven for Double Oven Models
NOTE: For better broiling, the lower oven is recommended.
Oven Cooking Guide (Cont.)

16 49-2000998 Rev. 1
CARE AND CLEANING: Air Fry Cooking Guide
Air Fry is a special, no-preheat, cooking mode that
is designed to produce foods with a crispier exterior
than traditional oven cooking. Select Air Fry, then
input the desired set temperature and press Start. The
temperature can be set between 300°F and 500°F.
Air Fry Cookware Guidelines
• Only use broil safe cookware when using Air Fry mode.
• A dark sheet pan is recommended. A dark pan
promotes better browning and crisping.
• Oven baking baskets and baking grids can also be
used. A sheet pan should be placed on the rack below
the foods to catch any drippings when using a baking
basket.
General Tips for Air Fry Mode
• The Air Fry mode is designed for cooking on a single
rack.
• The Air Fry mode is designed to be used without
preheating.
• Rack position 3 is recommended for most foods.
• Foods may cook faster than expected if the oven is
already hot when food is placed in the oven.
• When air frying foods with sauce, it is recommended to
apply the sauce at the end of cooking.
• If foods are browning too quickly, try a lower rack
position or lower oven set temperature.
• For packaged foods, use traditional oven cooking
instructions for set temperature and expected cook
time.
• It is not necessary to flip or stir food during cooking
• Arrange food in a single layer on the pan, do not
overload the pan.
• Always check internal food temperature to confirm
minimum safe temperatures have been reached.
Minimum safe food temperatures can be found on
packages and at IsItDoneYet.gov.
FOOD TYPE
RECOMMENDED
RACK POSITION(S)
RECOMMENDED
SET TEMPERATURES (F°)
RECOMMENDED
COOK TIME (MIN) NOTES
Fresh boneless fish or
poultry pieces, breaded such
as nuggets, tenders, fillets
3 375-400 15-30 Userlowersettemperaturesforlargerpieces.
Useshinycookware.
Fresh bone in
chicken wings 3 375-400 25-40 Salt wings or coat in a dry rub, if using sauce
apply after cooking or toward the end of cooking
Fresh bone in chicken
drumsticks or thighs 3 375-400 30-55 Userlowersettemperaturesforlargerpieces.
Fresh French fries,
thin(<½inch) 3 400-425 15-30
Parchment paper is recommended when
preparing fresh French fries. For crispier fries,
toss fries in corn starch or rice flour before
cooking.
Fresh French fries,
thick(>½inch) 3 375-400 20-35
Parchment paper is recommended when
preparing fresh French fries. For crispier fries,
toss fries in corn starch or rice flour before
cooking.
Frozen packaged
foods 3
Usetraditionaloven(notAirFry)cookinginstructionsasaguidelineforsettemperatureandcooktime.Additional
cook time beyond recommended package time may be required for some foods. If oven is hot when starting, food
may cook faster than the minimum package time.
Primary recommended cookware
Alternate cookware options
Air Fry Cooking Guide (on some models)

49-2000998 Rev. 117
A child or adult can tip the range and be killed.
Verify the anti-tip bracket has been properly installed
and engaged.
Ensure the anti-tip bracket is re-engaged when the range
is moved.
Do not operate the range without the anti-tip bracket in
place and engaged.
Failure to follow these instructions can result in death or
serious burns to children or adults.
Tip-Over Hazard
WARNING
Cleaning the Range – Exterior
WARNING If your range is removed for cleaning, servicing or any reason, be sure the
anti-tip device is reengaged properly when the range is replaced. Failure to
take this precaution could result in tipping of the range and can result in death
or serious burns to children or adults.
Be sure all controls are off and all surfaces are cool before cleaning any part of the range.
Control Knobs
The control knobs may be removed for easier cleaning.
Make sure the knobs are in the OFF positions and pull
them straight off the stems for cleaning.
The knobs can be washed with soap and water. Make
sure the inside of the knobs are dry before replacing.
Replace the knobs, in the OFF position to ensure proper
placement.
Control Lockout
If desired, the touch pads may be deactivated before
cleaning.
See Lock Controls in the Oven Controls section in this
manual.
Clean up splatters with a damp cloth.
You may also use a glass cleaner.
Remove heavier soil with warm, soapy water. Do not use
abrasives of any kind.
Reactivate the touch pads after cleaning.
Control Panel
It’s a good idea to wipe the control panel after each use.
Clean with mild soap and water or vinegar and water,
rinse with clean water and polish dry with a soft cloth.
Do not use abrasive cleansers, strong liquid cleansers,
plastic scouring pads or oven cleaners on the control
panel—theywilldamagethefinish.
Oven Exterior
Do not use oven cleaners, abrasive cleansers, strong
liquid cleansers, steel wool, plastic scouring pads, or
cleaning powders on the exterior of the oven. Clean with
a mild soap and water or vinegar and water solution.
Rinse with clean water and dry with a soft cloth. When
cleaning surfaces, make sure that they are at room
temperature and not in direct sunlight.
If stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up immediately. Let hot surfaces
cool, then clean and rinse.
Painted Surfaces
Painted surfaces include the sides of the range and the
door, top of control panel and the drawer front. Clean
these with soap and water or a vinegar and water solution.
Do not use commercial oven cleaners, cleaning powders,
steel wool or harsh abrasives on any painted surface.
Stainless Steel Surfaces
Do not use a steel wool pad; it will scratch the surface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
CleanerswithoxalicacidsuchasBarKeepersFriendSoft
Cleanser™ will remove surface rust, tarnish and small
blemishes.Useonlyaliquidcleanserfreeofgritandrubin
the direction of the brush lines with a damp, soft sponge.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end
of this manual.
Porcelain Enamel Cooktop
The porcelain enamel finish is sturdy but breakable if
misused. This finish is acid-resistant. However, any acidic
foodsspilled(suchasfruitjuices,tomatoorvinegar)
should not be permitted to remain on the finish.
If acids spill on the cooktop while it is hot, use a dry paper
towel or cloth to wipe it up right away. When the surface
has cooled, wash with soap and water. Rinse well.
For other spills such as fat spatterings, wash with soap
and water or cleansing powders after the surface has
cooled. Rinse well. Polish with a dry cloth.
CARE AND CLEANING: Cleaning the Range – Exterior

18 49-2000998 Rev. 1
Cleaning the Range – Interior
The interior of your new oven can be cleaned manually or by using Steam Clean or Self Clean modes.
Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration and
should be wiped up immediately. Let hot surfaces cool, then clean and rinse.
Manual Cleaning
Donotuseovencleaners(unlesscertifiedforself-
cleaningoven),abrasivecleaners,strongliquid
cleansers, steel wool, scouring pads, or cleaning
powders on the interior of the oven. Clean with a mild
soap and water or vinegar and water solution. Rinse with
clean water and dry with a soft cloth. When cleaning
surfaces, make sure that they are at room temperature.
Steam Clean Mode
Steam clean is intended to clean small spills using water and a lower cleaning temperature than Self-Clean.
To use the Steam Clean feature, wipe grease and soils
from the oven. Pour one cup of water into the bottom of
the oven. Close the door. Press the Steam Clean pad
and then press Start. The oven door will lock. Do not
open the door during the 30 minute steam clean as this
will decrease the steam clean performance. At the end of
the steam clean cycle the door will unlock. Wipe out any
excess water and any remaining soil.
Racks
All racks can be washed with warm, soapy water.
Enameled(notshiny)rackscanbeleftinthecavity
during self clean.
Racks may be more difficult to slide, especially after
a self-clean. Put some vegetable oil on a soft cloth or
paper towel and rub onto the left and right edges.
NOTE: Usingothercookingoilswillcauseadiscoloring
or a rust like color residue on the racks and cavity sides.
To clean this residue, use a soap and water or a vinegar
and water solution. Rinse with clean water and dry with a
soft cloth.
Oven Heating Elements
Do not clean the bake element or the broil element. Any
soil will burn off when the elements are heated.
To clean the oven floor, gently lift the bake element.
Clean the oven floor with warm, soapy water.
Wipe up heavy soil on the oven bottom.
Gently lift the bake element
CARE AND CLEANING:CleaningtheRange–Interior/CleaningtheGlassCooktop
Normal Daily Use Cleaning
To maintain and protect the surface of your glass cooktop,
follow these steps:
1. Before using the cooktop for the first time, clean it
with ceramic cooktop cleaner. This helps protect the
top and makes cleanup easier.
2. Regular use of ceramic cooktop cleaner will help keep
the cooktop looking new.
3. Shake the cleaning cream well. Apply a few drops of
ceramic cooktop cleaner directly to the cooktop.
4. Useapapertowelornon-scratchcleaningpadfor
ceramic cooktops to clean the entire cooktop surface.
5. Useadryclothorpapertoweltoremoveallcleaning
residue. No need to rinse.
NOTE: It is very important that you DO NOT heat the
cooktop until it has been cleaned thoroughly.
Clean your cooktop after
eachspill.Useceramic
cooktop cleaner.
For cleaning videos and
instructions, scan the QR
code with your device.
Ceramic
Cooktop
Cleaner
Cleaning the Glass Cooktop

49-2000998 Rev. 119
Burned-On Residue
NOTE: DAMAGE to your glass surface may occur if you
use scrub pads other than those recommended.
1. Allow the cooktop to cool.
2. Spread a few drops of ceramic cooktop cleaner on
the entire burned residue area.
3. Usinganon-scratchcleaningpadforceramic
cooktops, rub the residue area, applying pressure as
needed.
4. If any residue remains, repeat the steps listed above
as needed.
5. For additional protection,
after all residue has been
removed, polish the entire
surface with ceramic
cooktop cleaner and a
paper towel.
Heavy, Burned-On Residue
1. Allow the cooktop to cool.
2. Useasingle-edgerazorbladescraperatapproximately
a 45° angle against the glass surface and scrape the
soil. It will be necessary to apply pressure to the razor
scraper in order to remove the residue.
3. After scraping with the razor scraper, spread a few drops
of ceramic cooktop cleaner on the entire burned residue
area.Useanon-scratchcleaningpadtoremoveany
remaining residue.
4. For additional protection, after all residue has been
removed, polish the entire surface with ceramic
cooktop cleaner and a paper towel.
The ceramic cooktop scraper
and all recommended supplies
are available through our Parts
Center. See the Accessories and
Consumer Support sections at the
end of this manual.
NOTE: Do not use a dull or nicked
blade.
Useacleaningpadforceramic
cooktops.
CARE AND CLEANING: Cleaning the Glass Cooktop
Cleaning the Glass Cooktop (Cont.)
Metal Marks and Scratches
1. Be careful not to slide pots and pans across your
cooktop. It will leave metal markings on the cooktop
surface.
These marks are removable using the ceramic
cooktop cleaner with a non-scratch cleaning pad for
ceramic cooktops.
2. If pots with a thin overlay of aluminum or copper
are allowed to boil dry, the overlay may leave black
discoloration on the cooktop.
This should be removed immediately before heating
again or the discoloration may be permanent.
NOTE: Carefully check the bottom of pans for roughness
that would scratch the cooktop.
3. Be careful not to place aluminum baking sheets or
aluminum frozen entrée containers on a hot cooktop
surface. It will leave shinny dots or markings on the
cooktop surface. These markings are permanent and
cannot be cleaned off.
Damage from Sugary Spills and Melted Plastic
Special care should be taken when removing hot substances to avoid permanent damage of the glass surface.
Sugaryspillovers(suchasjellies,fudge,candy,syrups)ormeltedplasticscancausepittingofthesurfaceofyour
cooktop(notcoveredbythewarranty)unlessthespillisremovedwhilestillhot.Specialcareshouldbetakenwhen
removing hot substances.
Be sure to use a new, sharp razor scraper.
Do not use a dull or nicked blade.
1. Turn off all surface units. Remove hot pans.
2. Wearing an oven mitt:
a. Useasingle-edgerazorbladescrapertomove
the spill to a cool area on the cooktop.
b. Remove the spill with paper towels.
3. Any remaining spillover should be left until the surface
of the cooktop has cooled.
4. Don’t use the surface units again until all of the
residue has been completely removed.
NOTE: If pitting or indentation in the glass surface has
already occurred, the cooktop glass will have to be
replaced. In this case, service will be necessary.
Cooktop Seal
To clean the cooktop seal around the edges of the glass, lay a wet cloth on it for a few
minutes, then wipe clean with nonabrasive cleaners.

20 49-2000998 Rev. 1
CARE AND CLEANING: Oven Light
Oven Light
WARNING
SHOCK OR BURN HAZARD: Before replacing oven light bulb, disconnect the electrical power to the
range at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn.
CAUTION BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with
bare hands or a damp cloth can cause burns.
Oven Light Replacement (on some models)
To remove:
1.Turntheglasscovercounterclockwise1/4turnuntil
the tabs of the glass cover clear the grooves of the
socket. Wearing latex gloves may offer a better grip.
2.Usingglovesoradrycloth,removethebulbbypulling
it straight out.
To replace:
1.Useanew120/130-volthalogenbulb,nottoexceed
50 watts. Replace the bulb with the same type of bulb
that was removed. Be sure the replacement bulb is
rated120voltsor130volts(NOT12volts).
2.Usingglovesoradrycloth,removethebulbfromits
packaging. Do not touch the bulb with bare fingers. Oil
from skin will damage the bulb and shorten its life.
3. Push the bulb straight into the receptacle all the way.
4. Place the tabs of the glass cover into the grooves of
thesocket.Turntheglasscoverclockwise1/4turn.
For improved lighting inside the oven, clean the glass
cover frequently using a wet cloth. This should be
done when the oven is completely cool.
5. Reconnect electrical power to the oven.
Oven Light Replacement (on some models)
To remove:
1. Turn the glass cover
counterclockwise1/4turnuntilthe
tabs of the glass cover clear the
grooves of the socket. Wearing
latex gloves may offer a better grip.
2. Remove the bulb by turning it
counter-clockwise.
To replace:
1. Replace bulb with a new 40-watt appliance bulb.
Insert the bulb and turn it clockwise until it is tight.
2. Place the tabs of the glass cover into the grooves of
thesocket.Turntheglasscoverclockwise1/4turn.
For improved lighting inside the oven, clean the glass
cover frequently using a wet cloth. This should be
done when the oven is completely cool.
3. Reconnect electrical power to the oven.
G9 Bulb
Socket
Tab
Glass cover
Receptacle
Usegloves
or cloth
Receptacle
Oven Light Replacement (on some models)
The oven light bulb is covered with a removable glass cover that is held in place with a bail-shaped wire. Remove
the oven door, if desired, to reach the cover easily. See the Lift-Off Oven Door section for detailed oven door
removal instructions.
Replacing the Light Bulb:
1. Disconnect electrical power to the range.
2. Hold the glass cover stable, so it doesn’t fall when
released.
3. Slide near the indent of the cover holder until the
cover is released. Do not remove any screws to
release the glass cover.
4. Replace bulb with a 40-watt household appliance
bulb. Do not touch hot bulb with hand or wet
cloth. Only remove bulb when it is cool.
5. Hold glass cover stable over new bulb.
6. Pull the wire cover holder near the indent until the
indent in the
wire cover
holder is located
in the indent of
the glass cover.
7. Connect
electrical power
to range.
Wire cover holder
Indent
Glass cover
(onselfclean
modelonly)
Other manuals for JBS86
1
Table of contents
Other GE Oven manuals
Popular Oven manuals by other brands

Electrolux
Electrolux EOB9956XAX user manual

Merrychef
Merrychef EC402S Installation and operating instructions

Frigidaire
Frigidaire FEB755CEBG Control guide

Respekta
Respekta AB140-26 Installation & user's instructions

NEFF
NEFF B69VS7K 0 Series User manual and installation instructions

Miele
Miele H 6780 BP installation instructions

Smeg
Smeg Oven ALFA135B1 instruction manual

Beko
Beko MIN22100X user manual

Hardt
Hardt Blaze Operation manual

Wood Stone
Wood Stone TRADITIONAL SERIES WS-TS-5-W Installation and operation manual

Cres Cor
Cres Cor 500-CH-SS-DE Installation, operation and maintenance manual

Blodgett
Blodgett BE2136 DOUBLE Installation and operation