manuals.online logo
Brands
  1. Home
  2. •
  3. Brands
  4. •
  5. Char-Broil
  6. •
  7. Grill
  8. •
  9. Char-Broil 463230510 User manual

Char-Broil 463230510 User manual

Assembly instructions © 2009 PRODUCT GUIDEMODEL 463230510© 2009 Char-Broil, LLC Columbus, GA 31902Printed in China Serial NumberDate PurchasedIMPORTANT: Fill out the product record information below.See rating label on grill for serial number.For support and to register your grill, please visit us at www.charbroil.comEstimated assembly time: 35-40 minutesIf you have questions or need assistance during assembly, please call 1-800-241-7548.11/27/09 • G651-001-020801The following are trademarks registered by W.C. Bradley Co. in the U.S. Patent and Trademark Office: Caldera®; Charcoal2Go®; Char-Broil®; America's Legendary Barbeque Company®; American Gourmet®; Bandera®; Brush Hawg®; CB 940®; Char-Diamonds®; Char-Broil Charcoal/Gas®; Everybody Grills®; Everybody Outside®; FastStart®; Grill 2 Go®; Grill 2 Go® Express®; Grill Lovers®; Infrared Grilling That’s All About U®; Keepers of the Flame®; New Braunfels Smoker Company®; Patio Bistro®; Patio Caddie®; Patio Kitchen®; Pro-Sear®; RED®; Quantum®; Santa Fe®; Sear and Grill®; Sierra®; Signature Series®; Sure2Burn®; The Big Easy®; Trentino®; U®; Wild West Tradition®; and the following marks:®®Protected under one or more of the following U.S. Patents: 5,421,319; 5,458,309; 5,579,755; 5,996,573; 6,135,104; 6,279,566; 6,331,108; 6,484,900; 6,526,876; 6,595,197; 6,640,799; 6,640,803; 6,729,873; 6,739,473; 6,749,424; 6,792,935; 6,951,213; 7,047,590; 7,516,693; D364,535; D372,637; D373,701; D377,735; D383,035; D397,910; D405,643; D406,005; D406,009 ; D413,043; D413,229; D414,982; D415,388; D416,164; D416,441; D417,587; D417,588; D422,516; D423,274; D423,876; D428,303; D430,772; D435,396; D436,004; D438,059; D438,060; D438,427; D439,110; D442,505; D443,179; D443,354; D443,464; D447,384; D447,385; D447,909; D448,610; D448,614; D448,615; D448,616; D448,975; D449,492; D450,544; D451,759; D454,028; D454,031; D455,205; D455,206; D456,202; D456,222; D456,223; D457,789; D458,520; D458,760; D458,802; D459,088; D459,148 D459,149; D459,161; D459,163; D459,586; D459,943; D460,312; D460,313; D460,318; D461,359; D465,123; D465,693; D466,307; D466,439; D466,752; D473,414; D474,371; D477,498; D477,501; D477,504; D477,506; D477,746; D478,471; D478,472; D480,914; D491,410; D494,009; D494,413; D498,523; D500,359; D504,048; D530,098; D535,000; Canada:D97,504;D99,355; D102,037; D104,200;D108,377; 2,315,567; France:D010,231;D010,422;D010,590;D010,849; 1,089,646; South Korea: 384,565; United Kingdom: 2,099,402. Other Patents Pending. © 2009 W.C. Bradley CompanyThe following are trademarks of W.C. Bradley Co.: Advantage Series™; Auto-Clean™;Chef Tested™; Commercial Series™; Designer Series™;; Diamond Flame™; Double Chef™; Fireball™; Firenzy™; FlavorMaster™;Front Avenue™; Grill 2 Go® Advantage™; Hog and Yard Bird™; H20 Smoker™; Infrared. Grilling’s Juicy Little Secret™; Incredible Taste. Infallible Results™; Infrared Inside™; Insure™; Let’s Grill Something Together™; Lev-Alert™; Longhorn™; Magneto™; Precision Flame™; Quick2Burn™; QuickSet™; Ready When You Are™; Season, Set, And Savor™; Sizzle On The Grill™; Signature Series™; SureFire™; The Minute Grill™;Torchfork™; Universal Grill Parts™; You Bring the Party™ TEC™ is a trademark of Tec Infrared Grills.®
1.Do not store or use gasoline or other flammable liquids or vapors in the vicinity of this or any other appliance.2.An LP cylinder not connected for use shall not be stored in the vicinity of this or any other appliance.
WARNINGCAUTION
For residential use only. Do not use for commercial cooking.
DANGER
DANGER: Indicates an imminently hazardous situation which, if not avoided, will result in death or serious injury.
WARNING
WARNING: Indicates an potentially hazardous situation which, if not avoided, could result in death or serious injury.
CAUTION
CAUTION: Indicates a potentially hazardous situation or unsafe practice which, if not avoided, may result in minor or moderate injury.TABLE OF CONTENTSSafety SymbolsThe symbols and boxes shown below explain what each heading means. Read and follow all of the messages found throughout the manual.
DANGER
If you smell gas:1.Shut off gas to the appliance.2.Extinguish any open flame.3.Open lid.4.If odor continues, keep away from the appliance and immediately call your gas supplier or your fire department.THIS GRILL IS FOR OUTDOOR USE ONLY.
CAUTION:
Read and follow all safety statements, assembly instructions, and use and care directions before attempting to assemble and cook.
INSTALLER/ASSEMBLER:
Leave this manual with consumer.
CONSUMER:
Keep this manual for future reference.WARNING:Failure to follow all manufacturer’s instructions could result in serious personal injury and/or property damage.CAUTION:Some parts may contain sharp edges – especially as noted in the manual! Wear protective gloves if necessary.For Your Safety....................................2-3Grilling Guide......................................4-7Use and Care....................................8-13Limited Warranty....................................14Parts List..........................................15Parts Diagram......................................16Assembly.......................................17-26Troubleshooting..................................27-29Registration Card...................................312
WARNING
CALIFORNIA PROPOSITION 651. Combustion by-products produced when using this product contain chemicals known to the State of California to cause cancer, birth defects, and other reproductive harm.2. This product contains chemicals, including lead and lead compounds, known to the State of California to cause cancer, birth defects or other reproductive harm. Wash your hands after handling this product.Installation Safety Precautions•Use grill, as purchased, only with LP (propane) gas and the regulator/valve assembly supplied. If your grill is Dual Fuel ready,a conversion kit must be purchased for use with natural gas.•Grill installation must conform with local codes, or in their absence of local codes, with either the National Fuel Gas Code, ANSI Z223.1/ NFPA 54, Natural Gas and Propane Installation Code, CSA B149.1, or Propane Storage and Handling Code, B149.2, or the Standard for Recreational Vehicles, ANSI A 119.2/NFPA 1192, and CSA Z240 RV Series, Recreational Vehicle Code, as applicable. •All electrical accessories (such as rotisserie) must be electrically grounded in accordance with local codes, or National Electrical Code, ANSI / NFPA 70 or Canadian Electrical Code, CSA C22.1. Keep any electrical cords and/or fuel supply hoses away from any hot surfaces.•This grill is safety certified for use in the United States and/or Canada only. Do not modify for use in any other location. Modification will result in a safety hazard.
WARNING
Do not attempt to repair or alter the hose/valve/regulator for any “assumed” defect. Any modification to this assembly will void your warranty and create the risk of a gas leak and fire. Use only authorized replacement parts supplied by manufacturer.
CAUTION
Using pots larger than 6 quarts in capacity could exceed weight limit of theside burner shelfresulting in failureof grill cartcomponents.or side shelf,3
First Time UseRead your Assembly Manual and ensure the grill is put together properly. Remove all Point-of-Purchase advertising material from all grill surfaces before first use. We recommend operating your grill on its highest setting for 15-20 minutes prior to your first use. This aids in removing the oils used during manufacturing.Lava Rock / BriquettesThis gas grill has been designed, engineered, and tested to be used with flame tamers or heat distribution plates to provide more even heating, improve the cleaning process, and reduce flare-ups. The addition of after market lava rocks, charcoal, or briquettes of any type will cause poor combustion and increase the likelihood of a grease fire, and is not recommended. Using briquettes, lava rock, or charcoal in this grill will void your warranty. For extra smoke flavor, we recommend using a smoker box with wood chips.TemperatureThe temperature gauge in the hood of your new grill measures air temperature. The air temperature inside your grill will never be as hot as the temperature at the cooking surface.Note: Since 1995, all regulators (the part that attaches to the gas tank to regulate the flow of gas) have included a safety feature that restricts gas flow in the event of a gas leak. You can inadvertently activate this safety feature without having a gas leak. This typically occurs when you turn on the gas using the grill control knob before you turn on the LP tank valve. If the gas regulator safety feature activates, the grill will only reach temperatures between 250°F and 300°F even with all burners on the high setting.If your grill is not getting hotter than 250°F to 300°F these steps should be taken first to reset the gas regulator safety device:1. Open the grill lid.2. Turn off all knobs on the control panel in front.3. Turn off the tank knob.4. Disconnect the regulator from the LP tank.5. Wait 30 seconds.6. Reconnect the regulator to the LP tank.7. Slowly open the LP tank knob all the way. Do not put excessive force on the valve at the full open position to avoid damaging the valve.8. Turn on the appropriate control knob and light the grill per the instructions on the control panel.An illustration of this process is included in this Product Guide. See Troubleshooting section for additional information.Pre-Heating Your GrillJust like your home oven, your grill should be pre-heated to provide optimum performance. Pre-heat the grill on high for 10-15 minutes – longer if weather conditions require. Please refer to the lighting instructions inside the Product Guide if you have questions about how to light your grill. A match-light chain and hole is provided for your convenience.GRILLING GUIDE – Getting Started RegulatorCoupling Nut4
Outdoor grilling is really quite simple. You'll succeed with burgers, dogs, or steaks usually on your very first try. With experience, you will learn how to work with your grill, creating more imaginative meals all the time. This knowledge makes up the art of grilling. Before you start grilling, organize your food according to cooking technique and required cooking time, and optimize the use of your grilling area.Direct CookingDirect cooking involves grilling your meat directly over high heat. It is perfect for searing steaks, chops, and other smaller pieces of meat and vegetables that quickly make their way to the table. Indirect CookingIndirect cooking utilizes select burners to circulate heat throughout the grill, without direct contact between the meat and the flame. The meat is placed over the burner that is 'off'. This method is generally used to slow cook large cuts of meat and poultry. A pan can be placed underneath the meat to catch grease and food drippings, and helps minimize clean-up.Rotisserie CookingRotisserie cooking is best for 'round' meat, such as large roasts, whole poultry, and pork. It generally requires an accessory motor and spit rod that allows the meat to be turned at a constant speed. Rotisserie cooking is best done in front of a special rotisserie burner, or utilizing an indirect cooking burner arrangement. A pan can be placed underneath the meat to catch grease and food drippings, and helps minimize clean-up.Food SafetyFood safety is a very important part of enjoying the outdoor cooking experience. To keep food safe from harmful bacteria, follow these four basic steps:Clean: Wash hands, utensils, and surfaces with hot soapy water before and after handling raw meat.Separate: Separate raw meats from ready-to-eat foods to avoid cross contamination. Use a clean platter and utensils when removing cooked foods.Cook: Cook meat and poultry thoroughly to kill bacteria. Use a thermometer to ensure proper internal food temperatures.Chill: Refrigerate prepared foods and leftovers promptly.GRILLING GUIDE – Grilling 101 5
USDA Recommended Safe MinimumInternal TemperaturesBeef, Veal, Lamb, Steaks, & Roasts145° FFish145° FPork160° FBeef, Veal, Lamb Ground160° FEgg Dishes160° FTurkey, Chicken & Duck Whole,Pieces & Ground165° F
Cooking on your new grill is a hands-on experience, and it is recommended to remain outside with your grill while cooking. Grilling can be affected by many external conditions. In cold weather, you will need more heat to reach an ideal cooking temperature, and grilling may take longer. The meat's internal temperature and thickness can also affect cooking times. Cold and thicker meats will take longer to cook. Internal Meat TemperaturesMeat cooked on a grill often browns very fast on the outside. Therefore, use a meat thermometer to ensure it has reached safe internal temperatures.Please refer to the USDA for complete, up-to-date information. Our internal temperature chart is based on USDA standards for meat doneness. Check it out at SaucesSauces containing sugars and fats can cause flare-ups, and your food may burn. In general, apply these sauces during the final 10 minutes of cooking. Keep in mind, use of excessive sauces or glazes will also require extra cleaning afterwards.Marinades and RubsTo enhance the flavor of grilled foods, a liquid marinade or dry rub can be used prior to cooking. Meat can be either soaked or injected with liquid marinade up to 24 hours prior to grilling. Dry rubs can be applied directly to the meat immediately before grilling.www.isitdoneyet.govGRILLING GUIDE – Tips & Tricks Wood ChipsFor extra smoke flavor when grilling, try adding wood chips. Soak the chips in water for approximately 30 minutes before adding to a smoke box or pan. Place smoke box or pan on top of the cooking grate above the flame. Turn grill on high until the wood starts to smoke. Reduce heat to desired temperature for cooking, and place food on cooking grate as desired. Close lid to retain more smoke. Hardwood varieties that work particularly well with grilled foods include Alder, Apple, Cherry, Grapevines, Hickory, Mesquite, Oak, Rosemary and Sassafras.SkewersMetal skewers should be flat, with long handles. Round skewers allow food to roll when turned, so it may not cook as evenly. Use metal skewers when cooking meat kabobs. Wooden skewers should be soaked in water for an hour before use, and are best used for quick cooking foods such as vegetables and fruits.UtensilsUse tongs or a spatula to handle the food instead of a fork, and don't turn the food toooften. Piercing the foodwith a fork will releasejuices that you want inthe meat, and maycause flare-ups.6
Why Clean?We've all heard the saying, “an ounce of prevention is worth a pound of cure.” This is great advice when it comes to keeping your grill clean.Routine CarePeriodic cleaning of this grill is necessary,as grill fires can occur when grease andfood debris collect in the bottom of the grill. After each use, remove any remainingfood particles from the cooking grate andinside of the grill using a grill brush. Dothis after the grill has cooled down, yet isstill warm. It is much easier to clean foodparticles while warmth is still present, thanafter the food particles have completelycooled and hardened. This grill is notdesigned to be 'burned off' by closing thelid and turning the burners on High for anextended time. The excessive heatgenerated can cause leftover grease tocatch fire, and can cause permanentdamage to your grill.General CleaningPlastic parts: Wash with warm soapy water and wipe dry. Do not use abrasive cleaners, degreasers or a concentrated grill cleaner on plastic parts. Damage to and failure of parts can result.Porcelain surfaces: Because of glass-like composition, most residue can be wiped away with baking soda/water solution or glass cleaner. Use non-abrasive scouring powder for stubborn stains.Painted surfaces: Wash with mild detergent or non-abrasive cleaner and warm water. Wipe dry with a soft non-abrasive cloth.Stainless steel surfaces: Stainless steel can rust under certain conditions. This can be caused by environmental conditions such as chlorine or salt water, or impropercleaning tools such as wire or steelwool. It can also discolor due to heat,chemicals, or grease build-up. Tomaintain your grill's high qualityappearance, wash with mild detergentand warm water, or use a stainlesssteel grill cleaner. Baked-on greasedeposits may require the use of anabrasive plastic cleaning pad. Use onlyin direction of brushed finish to avoiddamage. Do not use abrasive pad onareas with graphics.GRILLING GUIDE – Cleaning Your Grill Cooking surfaces: If a bristle brush is used to clean any of the grill cooking surfaces, ensure no loose bristles remain on cooking surfaces prior to grilling. It is not recommended to clean cooking surfaces while grill is hot.Storing Your Grill• Clean cooking grates.• Store grill in dry location.• When LP cylinder is connected to grill, store outdoors in a well ventilated space and out of reach of children.• Cover grill if stored outdoors. Choose from a variety of grill covers offered by manufacturer.• Store grill indoors ONLY if LP cylinder is turned off, disconnected, and removed from grill. Never store LP cylinder indoors.• When removing grill from storage, follow the 'Cleaning the Burner Assembly' instructions in the Use and Care section of the Product Guide.CrittersSpiders like to make their homes in the venturi tubes of grills. These must be inspected and cleaned regularly to ensure there are no blockages. Refer to the Use and Care portion of this Product Guide for complete information.7
•NEVER store a spare LP cylinder under or near the appliance or in an enclosed area. •Never fill a cylinder beyond 80% full.•An over filled or improperly stored cylinder is a hazard due to possible gas release from the safety relief valve. This could cause an intense fire with risk of property damage, serious injury or death.•If you see, smell or hear gas escaping, immediately get away from the LP cylinder/appliance and call your fire department.
DANGER
USE AND CARELP Cylinder Removal, Transport and Storage•Turn OFF all control knobs and LP cylinder valve. Turn coupling nut counterclockwise by hand only - do not use tools to disconnect. Loosen cylinder screw beneath bottom shelf, then lift LP cylinder up and out of cart. Install safety cap onto LP cylinder valve. Always use cap and strap supplied with valve. Failure to use safety cap as directed may result in serious personal injury and/or property damage. •A disconnected LP cylinder instorage or being transportedmust have a safety cap installed (as shown).Do not store an LP cylinder in enclosed spacessuch as a carport, garage, porch, coveredpatio or other building. Never leave an LP cylinderinside a vehicle which may become overheatedby the sun.•Do not store an LP cylinder in an area where children play.OPD Hand WheelLP (Liquefied Petroleum Gas)•LP gas is nontoxic, odorless and colorless when produced. For Your Safety, LP gas has been given an odor (similar to rotten cabbage) so that it can be smelled. •LP gas is highly flammable and may ignite unexpectedly when mixed with air.LP Cylinder Filling•Use only licensed and experienced dealers.•LP dealer must purge new cylinder before filling.•Dealer should NEVER fill LP cylinder more than 80% of LP cylinder volume. Volume of propane in cylinder will vary by temperature.•A frosty regulator indicates gas overfill. Immediately close LP cylinder valve and call local LP gas dealer for assistance.•Do not release liquid propane (LP) gas into the atmosphere. This is a hazardous practice.•To remove gas from LP cylinder, contact an LP dealer or call a local fire department for assistance. Check the telephone directory under “Gas Companies” for nearest certified LP dealers.LP Cylinder ValveRetainer StrapSafetyCapLP Cylinder •The LP cylinder used with your grill must meet the following requirements:•Use LP cylinders only with these required measurements: 12" (30.5cm) (diameter) x 18" (45.7 cm) (tall) with 20 lb. (9 kg.) capacity maximum.•LP cylinders must be constructed and marked in accordance with specifications for LP cylinders of the U.S. Department of Transportation (DOT) or for Canada, CAN/CSA-B339, cylinders, spheres and tubes for transportation of dangerous goods. Transport Canada (TC). See LP cylinder collar for marking.•LP cylinder valve must have:•Type 1 outlet compatible with regulator or grill.•Safety relief valve.•UL listed Overfill Protection Device (OPD). This OPD safetyfeature is identified by a unique triangular hand wheel. Use only LP cylinders equipped with this type of valve.•LP cylinder must be arranged for vapor withdrawal and include collar to protect LP cylinder valve. Always keep LP cylinders in upright position during use, transit or storage.LP cylinder in upright position for vapor withdrawal 8
WARNING
If “growing” bubbles appear do not use or move the LP cylinder. Contact an LP gas supplier or your fire department!Connecting Regulator to the LP Cylinder1.LP cylinder must be properly secured onto grill. (Refer to assembly section.)2.Turn all control knobs to the OFF position.3.Turn LP cylinder OFF by turning hand-wheel clockwise to a full stop.4.Remove the protective cap from LP cylinder valve. Always use cap and strap supplied with valve.Safety Relief ValveNipple has to be centeredinto the LP cylinder valve.OPD Hand WheelType 1 outlet withthread on outside
c
k
w
o
l
i
s
C
e
f
f
O
Do not use a POL transport plug(plastic part with external threads)!It will defeat the safety feature ofthe valve.Strap and CapLP Cylinder Exchange•Many retailers that sell grills offer you the option of replacing your empty LP cylinder through an exchange service. Use only those reputable exchange companies that inspect, precision fill, test and certify their cylinders. Exchange your cylinder only for an OPD safety feature-equipped cylinder as described in the "LP Cylinder" section of this manual.•Always keep new and exchanged LP cylinders in upright position during use, transit or storage.•Leak test new and exchanged LP cylinders BEFORE connecting to grill.LP Cylinder Leak TestFor your safety•Leak test must be repeated each time LP cylinder is exchanged or refilled.•Do not smoke during leak test.•Do not use an open flame to check for gas leaks.•Grill must be leak tested outdoors in a well-ventilated area, away from ignition sources such as gas fired or electrical appliances. During leak test, keep grill away from open flames or sparks.•Use a clean paintbrush and a 50/50 mild soap and water solution. s Do not use household cleaning agents. Damage to gas train components can result.Brush soapy solution onto areas indicated by arrows in figure below.5.Hold regulator and insert nipple into LP cylinder valve. Hand-tighten the coupling nut, holding regulator in a straight line with LP cylinder valve so as not to cross-thread the connection.•Place dust cap on cylinder valve outlet whenever the cylinder isnot in use. Only install the type of dust cap on the cylinder valveoutlet that is provided with the cylinder valve. Other types of caps or plugs may result in leakage of propane.9
6.Turn the coupling nut clockwise and tighten to a full stop. The regulator will seal on the back-check feature in the LP cylinder valve, resulting in some resistance. An additional one-half to three-quarters turn is required to complete the connection. Tighten by hand only – do not use tools.NOTE:If you cannot complete the connection, disconnect regulator and repeat steps 5 and 6. If you are still unable to complete the connection, do not use this regulator!
Straight
Hold coupling nut and regulatoras shown for proper connectionto LP cylinder valve.
DANGER
•Do not insert any tool or foreign object into the valve outlet or safety relief valve. You may damage the valve and cause a leak. Leaking propane may result in explosion, fire, severe personal injury, or death.Leak Testing Valves, Hose and Regulator1.Turn all grill control knobs to OFF.2.Be sure regulator is tightly connected to LP cylinder.3.Completely open LP cylinder valve by turning hand wheel counterclockwise. If you hear a rushing sound, turn gas off immediately. There is a major leak at the connection. Correct before proceeding.4.Brush soapy solution onto areas circled below, or other similar5.If “growing” bubbles appear, there is a leak. Close LP cylinder valve immediately and retighten connections. If leaks cannot be stopped do not try to repair. Call for replacement parts. 6.Always close LP cylinder valve after performing leak test by turning hand wheel clockwise.NOTE: Sideburnershelf fascia notshown for clarity.•Outdoor gas appliance is not intended to be installed in or on a boat.•Outdoor gas appliance is not intended to be installed in or on an RV.•Never attempt to attach this grill to the self-contained LP gas system of a camper trailer or motor home.•Do not use grill until leak-tested.•If a leak is detected at any time, STOP and call the fire department.•If you cannot stop a gas leak, immediately close LPcylinder valve and call LP gas supplier or your fire department!
WARNING
fittings on your grill.NOTE: Your grillmay NOT beequipped with a sideburner.10
WARNING
For Safe Use of Your Grill and to Avoid Serious Injury:•Do not let children operate or play near grill. •Keep grill area clear and free from materials that burn.•Do not block holes in sides or back of grill. •Check burner flames regularly.•Use grill only in well-ventilated space. NEVER use in enclosed space such as carport, garage, porch, covered patio, or under an overhead structure of any kind.•Do not use charcoal or ceramic briquets in a gas grill. (Unless briquets are supplied with your grill.)•Use grill at least 3 ft. from any wall or surface. Maintain 10 ft. clearance to objects that can catch fire or sources of ignition such as pilot lights on water heaters, live electrical appliances, etc.•Apartment Dwellers:Check with management to learn the requirements and fire codes for using an LP gas grill in your apartment complex. If allowed, use outside on the ground floor with a three (3) foot clearance from walls or rails. Do not use on or under balconies.•NEVER attempt to light burner with lid closed. A buildup of non-ignited gas inside a closed grill is hazardous.•Never operate grill with LP cylinder out of correct position specified in assembly instructions. •Always close LP cylinder valve and remove coupling nut before moving LP cylinder from specified operation position.Safety TipssBefore opening LP cylinder valve, check the coupling nut for tightness.sWhen grill is not in use, turn off all control knobs and LP cylinder valve. sNever move grill while in operation or still hot.sUse long-handled barbecue utensils and oven mitts to avoid burns and splatters.sMaximum load for sideburner and side shelf is 10 lbs.sThe grease tray must be inserted into grill and emptied after each use. Do not remove grease tray until grill has completely cooled.s Clean grill often, preferably after each cookout. If a bristlebrush is used to clean any of the grill cooking surfaces,ensure no loose bristles remain on cooking surfaces prior togrilling. It is not recommended to clean cooking surfaceswhile grill is hot.sIf you notice grease or other hot material dripping from grill onto valve, hose or regulator, turn off gas supply at once. Determine the cause, correct it, then clean and inspect valve, hose and regulator before continuing. Perform a leak test.sKeep ventilation openings in cylinder enclosure (grill cart) free and clear of debris.sDo not store objects or materials inside the grill cart enclosure that would block the flow of combustion air to the underside of either the control panel or the firebox bowl.sThe regulator may make a humming or whistling noise during operation. This will not affect safety or use of grill.sIf you have a grill problem see the "Troubleshooting Section".sIf the regulator frosts, turn off grill and LP cylinder valve immediately. This indicates a problem with the cylinder and it should not be used on any product. Return to supplier!
CAUTION
•Putting out grease fires by closing the lid is not possible. Grills are well ventilated for safety reasons. •Do not use water on a grease fire. Personal injury may result. If a grease fire develops, turn knobs and LP cylinder off. •Do not leave grill unattended while preheating or burning off food residue on HI. If grill has not been regularly cleaned, a grease fire can occur that may damage the product. Ignitor Lightings Do not lean over grill while lighting.1.2.3.4.5.Turn OFF gas burner control valves. Turn ON gas at LP cylinder.Open lid during lighting.To ignite, push and turn ignition burner knob to HI. lights.6. If ignition does NOT occur in 5 seconds, turn the burner controls OFF, wait 5 minutes and repeat the lighting procedure.7. To ignite remaining burners, turn knob to the HI position starting with the burners closest to IGNITION BURNERS first.If ignitor does not work, follow match lighting instructions. P.ush and hold ELECTRONIC IGNITION button until the burner Lighting instructions are continued on the next page11
Burner Flame Check• Remove cooking grates and flame tamers. Light burners, rotate knobs from HI to LOW. You should see a smaller flame in LOW position than seen on HI. Perform burner flame check on sideburner, also. Always check flame prior to each use. If only low flame is seen refer to "Sudden drop or low flame" in the Troubleshooting Section.HILOWMatch-Lightings Do not lean over grill while lighting.1. Open lid. Turn ON gas at LP cylinder. 3. Push in and turn far right or far left burner knob to the HIburner lights and stays lit.4. Light adjacent burners in sequence by pushing knobs in and turning to the HI position.Turning Grill Off• Turn all knobs to the OFFposition. Turn LP cylinder OFF by turning hand-wheel clockwise to a full stop.Ignitor Check• Turn gas off at LP cylinder. Press and hold electronic ignitor button. "Click" should be heard and spark seen each time between each collector box or burner and electrode. See "Troubleshooting" if no click or spark.Valve Check• Important: Make sure gas is off at LP cylinder before checking valves. Knobs lock in position. To check valves, first push in knobs and release, knobs should spring back. If knobs do not spring back, replace valve assembly before using grill. Turn knobs to LOW position then turn back to position. Valves should turn smoothly. Hose Check• Before each use, check to see if hoses are cut or worn. Replace damaged hoses before using grill. Use only valve/hose/regulator specified by manufacturer.General Grill Cleaning • Do not mistake brown or black accumulation of grease and smoke for paint. Interiors of gas grills are not painted at the factory (and should never be painted). Apply a strong solution of detergent and water or use a grill cleaner with scrub brush on insides of grill lid and bottom. Rinse and allow to completely air dry. Do not apply a caustic grill/oven cleaner to painted surfaces. • Plastic parts: Wash with warm soapy water and wipe dry.s Do not use citrisol, abrasive cleaners, degreasers or a concentrated grill cleaner on plastic parts. Damage to and failure of parts can result. • Porcelain surfaces: Because of glass-like composition, most residue can be wiped away with baking soda/water solution or specially formulated cleaner. Use nonabrasive scouring powder for stubborn stains.• Painted surfaces: Wash with mild detergent or nonabrasive cleaner and warm soapy water. Wipe dry with a soft nonabrasive cloth.• Stainless steel surfaces: To maintain your grill’s high quality appearance, wash with mild detergent and warm soapy water and wipe dry with a soft cloth after each use. Baked-on grease deposits may require the use of an abrasive plastic cleaning pad. Use only in direction of brushed finish to avoid damage. Do not use abrasive pad on areas with graphics.• Cooking surfaces: If a bristle brush is used to clean any ofthe grill cooking surfaces, ensure no loose bristles remain oncooking surfaces prior to grilling. It is not recommended toclean cooking surfaces while grill is hot.OFF OFF
CAUTION
If ignition does NOT occur in 5 seconds, turn the burner controls OFF, wait 5 minutes and repeat the lighting procedure. If the burner does not ignite with the valve open, gas will continue to flow out of the burner and could accidently ignite with risk of injury.Turn controls and gas source or tank OFF when not in use.
WARNING
Sideburner Ignitor Lightings Do not lean over grill while lighting.1. Open sideburner lid. Turn ON gas at LP cylinder.2. Turn sideburner knob to the HI position, push and holdELECTRONIC IGNITOR button.3. If sideburner does NOT light within 5 seconds, turn knob to OFF, wait 5 minutes, then Sideburner Match Lighting1. Open sideburner lid. Turn ON2. Place lit match near burner.3. Turn sideburner knob to theBe sure burner lights andstays lit.2. Place match into match holder (hanging from side panel of grill). Light match; then light burner by placing match through the match light hole on right or left side of grill.HI position.8. For grills equipped with ELECTRONIC IGNITION atRepeat steps 4 through 6 to light each burner.9. Once each burner has ignited, turn knobs to desired setting.Ignitor Lighting (continued)each burner:gas at LP cylinder.repeat lighting procedure.position, depending on match light hole selected. Be sure12
Cleaning the Burner AssemblyFollow these instructions to clean and/or replace parts of burnerassembly or if you have trouble igniting grill.1. Turn gas OFF at control knobs and LP cylinder.2.Remove cooking grates and flame tamers. 3.Remove carryover tubes and burners.4.5.Carefully lift each burner up and away from valve openings.We suggest three ways to clean the burner tubes. Use the oneeasiest for you.(A)Bend a stiff wire (a light weight coat hanger works well) into a small hook. Run the hook through each burner tube several times.(B)Use a narrow bottle brush with a flexible handle (do not use a brass wire brush), run the brush through each burner tube several times.(C)Wear eye protection: Use an air hose to force air into the burner tube and out the burner ports. Check each port to make sure air comes out each hole.6.Wire brush entire outer surface of burner to remove food residue and dirt.7.Clean any blocked ports with a stiff wire such as an open paper clip.8.Check burner for damage, due to normal wear and corrosion some holes may become enlarged. If any large cracks or holes are found replace burner.VERY IMPORTANT: Burner tubes must reengage valveopenings. See illustrations at right. 9.Attach electrode to burner.10.Carefully replace burners.11.Attach burners to brackets on firebox.12.Reposition carryover tubes and attachto burners. Replace flame tamers andcooking grates.
CAUTION
Storing Your Grill• Clean cooking grates.• Store in dry location.• When LP cylinder is connected to grill, store outdoors in a well-ventilated space and out of reach of children.• Cover grill if stored outdoors. Choose from a variety of grill covers offered by manufacturers.• Store grill indoors ONLY if LP cylinder is turned off and disconnected, removed from grill and stored outdoors.• When removing grill from storage, follow “Cleaning the Burner Assembly” instructions before starting grill.
Firebox
Carryover tube
FireboxburnerbracketElectrodeSPIDER ALERT!VALVECONTROL PANELSPIDER WEBSINSIDE VENTURIIf you notice that your grill is getting hard to light or that the flame isn’t as strong as it should be, take the time to check and clean the venturi’s.In some areas of the country, spiders or small insects have been known to create “flashback” problems. The spiders spin webs, build nests and lay eggs in the grill’s venturi tube(s) obstructing the flow of gas to the burner. The backed-up gas can ignite in the venturi behind the control panel. This is known as a flashback and it can damage your grill and even cause injury.To prevent flashbacks and ensure good performance the burner and venturi assembly should be removed from the grill and cleaned before use whenever the grill has been idle for an extended period.BURNERSPIDER AND WEBSINSIDE BURNER TUBECorrectburner-to-valveengagementDetach electrode from burner. NOTE: Removal/Detachment method will depend on the burner configuration. See different configurations in illustrations below.Remove screws
Firebox
Carryover tube
Firebox burnerbracketPry off electrode with a flat blade screwdriverElectrode13
This warranty only applies to units purchased from an authorized retailer. Manufacturer warrants to the original consumer-purchaser only that this product shall be free from defects in workmanship and materials after correct assembly and under normal and reasonable home use for the periods indicated below beginning on the date of purchase*. The manufacturer reserves the right to require that defective parts be returned, postage and or freight pre-paid by the consumer for review and examination. *Note: A dated sales reciept WILL be required for warranty service. The original consumer-purchaser will be responsible for all shipping charges for parts replaced under the terms of this limited warranty.This limited warranty is applicable in the United States and Canada only, is only available to the original owner of the product and is not transferable. Manufacturer requires proof of your date of purchase. Therefore, you should retain your sales slip or invoice. Registering your product is not a substitute for proof of purchase and the manufacturer is not responsible for or required to retain proof of purchase records. This limited warranty applies to the functionality of the product ONLY and does not cover cosmetic issues such as scratches, dents, corrosions or discoloring by heat, abrasive and chemical cleaners or any tools used in the assembly or installation of the appliance, surface rust, or the discoloration of stainless steel surfaces. This limited warranty will not reimburse you for the cost of any inconvenience, food, personal injury or property damage. ITEMS MANUFACTURER WILL NOT PAY FOR:1. Shipping cost, standard or expedited, for warranty and replacement parts 2. Service calls to your home.3. Repairs when your product is used for other than normal, single-family household or residential use. acts of God, improper installation or maintenance, installation not in accordance with electrical or plumbing codes, or use of products not approved by the manufacturer.5. Any food loss due to product failures or operating difficulties.6. Replacement parts or repair labor costs for units operated outside the United States or Canada.7. Pickup and delivery of your product.8. Repairs to parts or systems resulting from unauthorized modifications made to the product.9. The removal and/or reinstallation of your product. DISCLAIMER OF IMPLIED WARRANTIES and LIMITATION OF REMEDIESRepair or replacement of defective parts is your exclusive remedy under the terms of this limited warranty. In the event of parts availability issues, Manufacturer will not be responsible for any consequential or incidental damages arising from the breach of either this limited warranty or any applicable implied warranty, or for failure or damage resulting from acts of God, improper care and maintenance, grease fire, accident, alteration, replacement of parts by anyone other than Manufacturer, misuse, transportation, commercial use, abuse, hostile environments (inclement weather, acts of nature, animal tampering), improper installation or installation not in accordance with local codes or printed manufacturer instructions. THIS LIMITED WARRANTY IS THE SOLE EXPRESS WARRANTY GIVEN BY THE MANUFACTURER. NO PRODUCT PERFORMANCE SPECIFICATION OR DESCRIPTION WHEREVER APPEARING IS WARRANTED BY MANUFACTURER EXCEPT TO THE EXTENT SET FORTH IN THIS LIMITED WARRANTY. ANY IMPLIED WARRANTY PROTECTION ARISING UNDER THE LAWS OF ANY STATE, INCLUDING IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE OR USE, IS HEREBY LIMITED IN DURATION TO THE DURATION OF THIS LIMITED WARRANTY.Neither dealers nor the retail establishment selling this product has any authority to make any additional warranties or to promise remedies in addition to or inconsistent with those stated above. Manufacturer's maximum liability, in any event, shall not exceed the purchase price of the product paid by the original consumer. NOTE: Some states do not allow an exclusion or limitation of incidental or consequential damages, so some of the above limitations or exclusions may not apply to you. This limited warranty gives you specific legal rights as set foth herein. You may also have other rights which vary from state to state. In the state of California only, if refinishing or replacement of the product is not commercially practicable, the retailer selling this product or the Manufacturer will refund the purchase price paid for the product, less the amount directly attributable to use by the original consumer-purchaser prior to discovery of the nonconformity. In addition, in the state of California only, you may take the product to the retail establishment selling this product in order to obtain performance under this limited warranty.If you wish to obtain performance of any obligation under this limited warranty, you should write to:Consumer RelationsP. O. Box 1240Columbus, GA 31902-1240Consumer returns will not be accepted unless a valid Return Authorization is first acquired. Authorized returns are clearly marked on the outside of the package with an RA number and the package is shipped freight/postage pre-paid. Consumer returns that do not meet these standards will be refused. LIMITED WARRANTY4. Damage, failures, or operating difficulties resulting from accident, alteration, careless handling, misuse, abuse, fire, flood,RUST is not considered a manufacturing or materials defect.the manufacturer reserves the right to substitute like or similar parts that are equally functional. SCOPE OF COVERAGEPERIOD OF COVERAGETYPE OF FAILURE COVERAGEPERFORATION, MANUFACTURING,AND MATERIAL DEFECTS ONLYAll Parts1 year from date of purchase*14
PARTS LIST
KeyQtyDescriptionA1FIREBOXB5MAIN BURNER-TUBE BURNERC1MAIN BURNER-BAR BURNERD1ELECTRODE, F/ TUBE BURNERE1ELECTRODE, F/ BAR BURNERF4CARRY OVER TUBEG1CONTROL PANEL, MAINH1ELECTRONIC IGNITION MODULEI1BUTTON, F/ IGNITION MODULEJ1SHEILD, F/ ELECTRONIC IGNITION MODULEK1
HOSE VALVE REGULATOR ASSEMBLYL7BEZEL F/ CONTROL KNOBM7CONTROL KNOBN1TOP LIDO1LOGO PLATE F/ LIDP1TEMPERATURE GAUGEQ1BEZEL, F/ TEMPERATURE GAUGER2LID BUMPER, RECTANGLES2LID BUMPER, ROUNDT1TOP LID HARDWAREU1HANDLE, F/ LIDV5HEAT TENTW4COOKING GRATEX1WARMING RACKY1LEFT SIDE SHELF F/ SBZ1DRIP PAN, F/ SBAA1SIDEBURNER GRATEBB1ELECTRODE, F/ SBCC1ELECTRODE WIRE, F/ SIDEBURNERDD1SIDEBURNER LIDEE1SIDEBURNER FF1SIDEBURNER VALVE CLIPGG1CONTROL PANEL, F/ SBHH1RIGHT SIDE SHELFII1FASCIA, F/ RIGHT SHELFJJ1TOWEL BARKK5TOOL HOOKLL1RIGHT SIDE CART PANELMM1LEFT SIDE CART PANELNN1BOTTOM SHELFOO1FRONT DOOR BRACE15
KeyQtyDescriptionPP1LEFT DOORQQ1RIGHT DOORRR2HANDLE, F/ DOORSS1LOWER BACK PANELTT2TANK EXCLUSION WIREUU1GREASE TRAYVV1GREASE PANWW4CASTER SOCKETSXX2CASTER, LOCKINGYY2CASTER, FIXEDZZ2MATCH HOLDERAAA1TANK RETAINER SCREWBBB2MAGNET ASSEMBLYCCC1HEAT SHIELD, F/ TANKNOT Pictured…1CASTER WRENCH…1PRODUCT MANUAL, ENGLISH…1PRODUCT MANUAL, FRENCH…1HARDWARE PACK
PARTS DIAGRAMW
V
NCCBCDEBBBBPOTSQRIHIIJJAGGGHHMTTNNKBBEEAAZYXFFUFFFFDDLLLLLLMMMMMRRKKYYPPVVWWMMXXZZLLLMQQOOAAASSJBBBBBBZZWWTTRRKKKKKKKKWWW
VVVV
UUCCC16
1/4-20x2-3/8"Machine Screw"Qty. 6ASSEMBLY1•Place bottom shelf between side panels . Attach to left and right side panels with (4) 1/4”-20x2-3/8” machine screws and 1/4”-20 flange nuts at front, and (2) 1/4”-20x2-3/8” machine screws and 1/4”-20 flange nuts at rear.with cut out hole for LP cylinder on left121/4-20Flange Nut"Qty. 6•Place lower back panel between side panels as shown. Attach to left and right side panels with (4) #8-32x3/8” sheet metal screws. Then attach to bottom shelf with (2) #8-32x3/8” sheet metal screws.Sheet Metal ScrewsQty. 6#8-32x3/8" Left Side PanelRight Side PanelRight Side PanelLeft Side PanelMagnet AssemblyLower Back PanelFor Front Door Brace AssemblyBottom Shelf
RearFront
Bottom Shelf17
3•Hook tank exclusion wire onto the metal taps on lower back panel, attach other ends to bottom shelf with #8-32x3/8” sheet metal screws.4•Attach to left and right side panels with flange nuts.Place front door brace as shown. 1/4"-20x2-3/8" machine screws and 1/4”-20 Sheet Metal ScrewsQty. 2#8-32x3/8" Front Door Brace1/4-20Flange Nut"Qty. 41/4-20x2-3/8"Machine Screw"Qty. 4Metal TapLower Back Panel18
5••Attach the two fixed casters to left leg and the two locking casters to right leg. Use the provided caster wrench to fully tighten casters.Turn assembly upside down. Caster WrenchLocking CasterFixed CasterLeft Side PanelRight Side Panel19
6•Stand cart upright. •This step requires two people to lift and position grill head onto cart.•Carefully lower the grill head onto the cart. Make sure the regulator hose is hanging outside the cart. Attach with 1/4”-20x1/2” screws.1/4-20x1/2" Screw"Qty. 4Grill HeadRight side panel removed for clarity20

Other manuals for 463230510

1

Other Char-Broil Grill manuals

Char-Broil 463244012 User manual

Char-Broil

Char-Broil 463244012 User manual

Char-Broil 4651330 User manual

Char-Broil

Char-Broil 4651330 User manual

Char-Broil 19659160 User manual

Char-Broil

Char-Broil 19659160 User manual

Char-Broil T-47G User manual

Char-Broil

Char-Broil T-47G User manual

Char-Broil PERFORMANCE CORE 468503322 User manual

Char-Broil

Char-Broil PERFORMANCE CORE 468503322 User manual

Char-Broil 463239915 User manual

Char-Broil

Char-Broil 463239915 User manual

Char-Broil 463270309 User manual

Char-Broil

Char-Broil 463270309 User manual

Char-Broil 463270611 User manual

Char-Broil

Char-Broil 463270611 User manual

Char-Broil Convective 210 B User manual

Char-Broil

Char-Broil Convective 210 B User manual

Char-Broil PATIO BISTRO 180 Use and care manual

Char-Broil

Char-Broil PATIO BISTRO 180 Use and care manual

Char-Broil Patio Bistro 180 14601897 User manual

Char-Broil

Char-Broil Patio Bistro 180 14601897 User manual

Char-Broil 10201566 User manual

Char-Broil

Char-Broil 10201566 User manual

Char-Broil Patio Bistro 11601558 User manual

Char-Broil

Char-Broil Patio Bistro 11601558 User manual

Char-Broil 463670812 User manual

Char-Broil

Char-Broil 463670812 User manual

Char-Broil American Gourmet 12201729 User manual

Char-Broil

Char-Broil American Gourmet 12201729 User manual

Char-Broil 463622513 User manual

Char-Broil

Char-Broil 463622513 User manual

Char-Broil 463470109 User manual

Char-Broil

Char-Broil 463470109 User manual

Char-Broil 11301674 User manual

Char-Broil

Char-Broil 11301674 User manual

Char-Broil Patio Bistro TRU Infrared 12601578 User manual

Char-Broil

Char-Broil Patio Bistro TRU Infrared 12601578 User manual

Char-Broil Judge 06308410 User manual

Char-Broil

Char-Broil Judge 06308410 User manual

Char-Broil 463821507 User manual

Char-Broil

Char-Broil 463821507 User manual

Char-Broil 463820208 User manual

Char-Broil

Char-Broil 463820208 User manual

Char-Broil Patio Caddie 4654870 User manual

Char-Broil

Char-Broil Patio Caddie 4654870 User manual

Char-Broil Professional Core 468863021 User manual

Char-Broil

Char-Broil Professional Core 468863021 User manual

Popular Grill manuals by other brands

TEC Infra-red Cherokee CH-10SS owner's manual

TEC Infra-red

TEC Infra-red Cherokee CH-10SS owner's manual

AmazonBasics B0B8QV3MS2 user manual

AmazonBasics

AmazonBasics B0B8QV3MS2 user manual

George Foreman GFF2022 instructions

George Foreman

George Foreman GFF2022 instructions

tepro CRANFORD instruction manual

tepro

tepro CRANFORD instruction manual

EXPERT GRILL XG18-101-002-07 owner's manual

EXPERT GRILL

EXPERT GRILL XG18-101-002-07 owner's manual

Onward Huntington 2122-64 Assembly manual & parts list

Onward

Onward Huntington 2122-64 Assembly manual & parts list

Monument Grills Chaparral 700 Assembly & operating instructions

Monument Grills

Monument Grills Chaparral 700 Assembly & operating instructions

Summerset Professional Grills SS27PRO owner's manual

Summerset Professional Grills

Summerset Professional Grills SS27PRO owner's manual

RiverGrille GR1038-014612 owner's manual

RiverGrille

RiverGrille GR1038-014612 owner's manual

Movelar BAILEN PLUS 2 SIDE-STANDS Assembly instructions

Movelar

Movelar BAILEN PLUS 2 SIDE-STANDS Assembly instructions

Outback THG2710 Assembly and operating instructions

Outback

Outback THG2710 Assembly and operating instructions

Broil King PORTA-CHEF 422-32 Assembly manual & parts list

Broil King

Broil King PORTA-CHEF 422-32 Assembly manual & parts list

Magma Monterey II A10-1225-2 owner's manual

Magma

Magma Monterey II A10-1225-2 owner's manual

Weber Spirit E210 CLASSIC owner's guide

Weber

Weber Spirit E210 CLASSIC owner's guide

TEFAL ULTRACOMPACT 600 GC300335 manual

TEFAL

TEFAL ULTRACOMPACT 600 GC300335 manual

IKEA KLASEN user manual

IKEA

IKEA KLASEN user manual

Prokan BS04-BI-LP Assembly instructions & user manual

Prokan

Prokan BS04-BI-LP Assembly instructions & user manual

Kenmore Kenmore 415.16237 Use & care manual

Kenmore

Kenmore Kenmore 415.16237 Use & care manual

manuals.online logo
manuals.online logoBrands
  • About & Mission
  • Contact us
  • Privacy Policy
  • Terms and Conditions

Copyright 2025 Manuals.Online. All Rights Reserved.