GE JGAS640 User manual

Write the model and serial
numbers here:
Model #_________________
Serial # _________________
You can find the rating label on the
front behind the range storage or
broil drawer.
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
OWNER’S MANUAL
RANGES
Gas Compact
49-2001073 Rev. 1 05-22 GEA
Hotpoint Models
RGAS200
RGAS300
GE Model
JGAS640
GE is a trademark of the General Electric Company. Manufactured under trademark license.
SAFETY INFORMATION .......... 3
USING THE RANGE
In Case of a Power Failure ............... 7
Surface Burners ........................ 7
Oven Controls.......................... 9
Sabbath Mode.......................... 9
Cookware Guidelines....................10
Cooking Modes.........................10
Oven Racks ............................11
Oven Air Vents .........................11
Aluminum Foil and Oven Liners...........11
Cooking Guide .........................12
CARE AND CLEANING
Oven ..................................13
Cooktop ...............................14
Door and Drawer .......................16
Oven Light.............................16
Oven Door .............................17
TROUBLESHOOTING TIPS........18
LIMITED WARRANTY ............ 22
ACCESSORIES .................... 23
CONSUMER SUPPORT ...........24

249-2001073 Rev. 1
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.

49-2001073 Rev. 1 3
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
WARNING If the information in this manual is not followed exactly, a fire or
explosion may result, causing property damage, personal injury or death.
- Do not store or use gasoline or other flammable vapors and liquids in the vicinity of
this or any other appliance.
- WHAT TO DO IF YOU SMELL GAS
■ Donottrytolightanyappliance.
■ Donottouchanyelectricalswitch;donotuseanyphoneinyourbuilding.
■ Immediatelycallyourgassupplierfromaneighbor’sphone.Followthegas
supplier’sinstructions.
■ Ifyoucannotreachyourgassupplier,callthefiredepartment.
- Installation and service must be performed by a qualified installer, service agency or
the gas supplier.
WARNING Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
ANTI-TIP DEVICE
To reduce the risk of tipping the range, the range
must be secured by a properly installed anti-tip
bracket. See installation instructions shipped
with the bracket for complete details before
attempting to install.
For Free-Standing Ranges
To check if the bracket is installed, ensure
there is no cookware on top of the range and all
surfaces are cool to the touch. Carefully slide
out the range from the wall approximately three
inches. Look behind the range to see if there is
a metal bracket attached to the floor or the wall. To check if the bracket is installed correctly, grasp the back of
the range, being careful not to grab or bend the rear trim piece. Tilt the range forward
slightly and confirm the anti-tip bracket engages the back of the range, limiting the
forward tip of the range. If the anti-tip bracket does not engage the range and prevent
it from tipping, verify the anti-tip bracket has been properly installed. If this does not
solve the problem or the anti-tip bracket is not present, call 800.626.8774 in the US or
800.561.3344 in Canada.
If the range is pulled from the wall for any reason, always repeat this procedure to verify
the range is properly secured by the anti-tip bracket.
Never completely remove the leveling legs or the range will not be secured to the anti-tip
device properly.
Anti-Tip
Bracket
Free-Standing Ranges
• A child or adult can tip the range and be killed.
• Verify the anti-tip bracket has been properly
installed and engaged.
• Ensure the anti-tip bracket is re-engaged when
the range is moved.
• Do not operate the range without the anti-tip bracket
in place and engaged.
• Failure to do so can result in death or serious burns
to children or adults.
Tip-Over Hazard
WARNING

449-2001073 Rev. 1
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING GENERAL SAFETY INSTRUCTIONS
WARNING
NEVER use this appliance
as a space heater to heat or warm the room.
Doing so may result in carbon monoxide
poisoning and overheating of the oven.
■ Usethisapplianceforitsintendedpurposeas
described in this owner’s manual.
■ Haveyourrangeinstalledandproperlygroundedby
a qualified installer in accordance with the provided
installation instructions.
■ Anyadjustmentandserviceshouldbeperformed
only by a qualified gas range installer or service
technician. Do not attempt to repair or replace
any part of your range unless it is specifically
recommended in this manual.
■ Yourrangeisshippedfromthefactorysetforuse
with natural gas. It can be converted for use with
propane gas. If required, these adjustments must be
made by a qualified technician in accordance with
the installation instructions and local codes. The
agency performing this work assumes responsibility
for the conversion.
■ Havetheinstallershowyouthelocationofthe
range gas shut-off valve and how to turn it off if
necessary.
■ Plugyourrangeintoa120-voltgroundedoutlet
only. Do not remove the round grounding prong
from the plug. If in doubt about the grounding of the
home electrical system, it is your responsibility and
obligation to have an ungrounded outlet replaced
with a properly grounded, three prong outlet in
accordance with the National Electrical Code. Do
not use an extension cord with this appliance.
■ Beforeperforminganyservice,unplugtherange
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
■ Besureallpackingmaterialsareremovedfromthe
range before operating to prevent ignition of these
materials.
■ Avoidscratchingorimpactingglassdoors,
cooktops, or control panels. Doing so may lead
to glass breakage. Do not cook on a product with
broken glass. Shock, fire, or cuts may occur.
■ Donotleavechildrenaloneorunattendedinan
area where an appliance is in use. They should
never be allowed to climb, sit or stand on any part
of the appliance.
■
CAUTION
Do not store items of interest
to children in cabinets above an oven - children
climbing on the oven to reach items could be
seriously injured.
■ Neverblockthevents(airopenings)oftherange.
They provide the air inlets and outlets that are
necessary for the range to operate properly with
correct combustion. Air openings are located at the
rear of the cooktop, at the top and bottom of the
oven door, and at the bottom of the range under the
warming drawer, lower oven drawer or kick panel.
■ Useonlydrypotholders—moistordamppot
holders on hot surfaces may result in burns from
steam. Do not let pot holders touch surface burners,
burner grate, or oven heating element. Do not use a
towel or other bulky cloth in place of pot holders.
■ Donottouchtheheatingelementsortheinterior
surface of the oven. These surfaces may be hot
enough to burn even though they are dark in color.
During and after use, do not touch, or let clothing
or other flammable materials contact any interior
area of the oven; allow sufficient time for cooling
first. Other surfaces of the appliance may become
hotenoughtocauseburns.Potentiallyhotsurfaces
include the burners, grates, oven vent opening,
surfaces near the opening, and crevices around the
oven door.
■ Donotheatunopenedfoodcontainers.Pressure
could build up and the container could burst,
causing an injury.
■ Cookfoodthoroughlytohelpprotectagainst
foodborne illness. Minimum safe food temperature
recommendations can be found at
IsItDoneYet.gov and fsis.usda.gov. Use a food
thermometer to take food temperatures and check
several locations.
■ Donotallowanyonetoclimb,standorhangonthe
oven door, drawer or cooktop. They could damage
the range or tip it over causing severe injury or death.

49-2001073 Rev. 1 5
WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
Failure to do so may result in fire or personal injury.
■ Donotstoreoruseflammablematerialsinanoven
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
■ Neverwearloose-fittingorhanginggarmentswhile
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
■ Donotletcookinggreaseorotherflammable
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
READ AND SAVE THESE INSTRUCTIONS
WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
■ Donotusewaterongreasefires.Neverpickup
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
tray. Use a multi-purpose dry chemical or foam-type
fire extinguisher.
■ Ifthereisafireintheovenduringbaking,smother
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
■ Ifthereisafireintheovenduringself-clean,turn
the oven off and wait for the fire to go out. Do not
force the door open. Introduction of fresh air at self-
clean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
WARNING COOKTOP SAFETY INSTRUCTIONS
WARNING
NEVER Operate the
Top Surface Cooking Section of this
Appliance Unattended.
•Failure to follow this warning
statement could result in fire,
explosion, or burn hazard that could
cause property damage, personal
injury, or death.
•If a fire should occur, keep away from
the appliance and immediately call
your fire department.
DO NOT ATTEMPT TO EXTINGUISH
AN OIL/GREASE FIRE WITH WATER.
■ Neverleavethesurfaceburnersunattendedat
medium or high heat settings. Foods, especially oily
foods, may ignite resulting in fire that could spread
to surrounding cabinets.
■ Neverleaveoilunattendedwhilefrying.Ifallowed
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
cabinets. Use a deep fat thermometer whenever
possible to monitor oil temperature.
■ Toavoidoilspilloverandfire,usetheminimum
amount of oil when using a shallow pan-frying
and avoid cooking frozen foods with excessive
amounts of ice.
■ Useproperpansizeandavoidpansthatare
unstable or easily tipped. Select cookware that is
matched to the size of the burner. Burner flames
should be adjusted so that they do not extend
beyond the bottom of the pan. Excessive flame may
be hazardous.
■ AlwaysusetheLITEpositionwhenignitingthetop
burners and make sure the burners have ignited.
■ Whenusingglass/ceramiccookware,makesureit
is suitable for cooktop service; others may break
because of sudden change in temperature.
■ Tominimizethepossibilityofburns,ignitionof
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby burners.
■ Donotuseawokwitharoundmetalsupportring.
The ring may trap heat and block air to the burner
resulting in a carbon monoxide hazard.
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE

649-2001073 Rev. 1
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
READ AND SAVE THESE INSTRUCTIONS
WARNING OVEN SAFETY INSTRUCTIONS
WARNING
NEVER cover any slots,
holes, or passages in the oven bottom or
cover an entire rack with materials such as
aluminum foil or oven liners. Doing so blocks
air flow through the oven and may cause
carbon monoxide poisoning. Never place foil
or oven liners on the oven bottom. They can
trap heat causing risk of smoke or fire.
■ Standawayfromtherangewhenopeningtheoven
door. Hot air or steam which escapes can cause
burnstohands,faceand/oreyes.
■ Neverplacecookingutensils,pizzaorbakingstones,
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.
■ Placeovenracksindesiredlocationwhileovenis
cool. If rack must be moved while oven is hot, be
careful to avoid touching hot surfaces.
■ Donotleaveitemssuchaspaper,cookingutensils,
or food in the oven when not in use. Items stored in
an oven can ignite.
■ Donotleaveitemsonthecooktopneartheoven
vent. Items may overheat resulting in a risk of fire or
burns.
■ Neverbroilwithdooropen.Open-doorbroilingis
not permitted due to overheating of control knobs.
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface. Do not use any sharp items to remove the film.
Remove all of the film before using the appliance for the
first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
Consider recycling options for your appliance packaging
material.
WARNING COOKTOP SAFETY INSTRUCTIONS (Cont.)
■ Donotattempttoliftthecooktop.Doingsomay
damage the gas tubing to the surface burners
resulting in a gas leak and risk of fire.
■ Donotusealuminumfoiltocoverthegratesor
line any part of the cooktop. Doing so may result
in carbon monoxide poisoning, overheating of the
cooktop surfaces, or a potential fire hazard.
PROPER DISPOSAL OF YOUR APPLIANCE
Dispose of or recycle your appliance in accordance with Federal and Local Regulations. Contact your local
authorities for the environmentally safe disposal or recycling of your appliance.

49-2001073 Rev. 1 7
In Case of a Power Failure
USING THE RANGE: InCaseofaPowerFailure/SurfaceBurners
Surface Burner
The round burner is for general cooking purposes. Size
cookware appropriately to the flames.
Surface Burners
In the event of a power failure, the oven is inoperable
and no attempt should be made to operate it. However,
the surface burners may be lit with a match. Using
extreme caution, hold a lit match near the ports beneath
the surface burner cap, then slowly turn the knob to the
LITE position. Once lit, surface burners will continue to
operate normally.
Lighting a Surface Burner
WARNING Burners should be operated only
when covered by cookware. Burner flames not
covered by cookware present a risk of fire or
clothing ignition. Never let flames extend beyond the
sides of the cookware. Failure to comply may result
in serious injury.
Make sure all burners are in their correct locations and
fully assembled before attempting to operate any burner.
Selectaburnerandfinditscontrolknob.Pushtheknob
in and turn it to the LITE position.
Youwillhearaclickingnoise—
the sound of the electric spark
igniting the burner. When one
burner is turned to LITE, all
burners will spark. Sparking will
continue as long as the knob
remains at LITE. Once gas is
ignited, turn the knob to adjust
the flame size.
Using the Surface Burners
NOTES:
■ Donotoperatetheburnerforanextendedperiodof
time without cookware on the grate. The finish on
the grate may discolor or chip without cookware to
absorb the heat.
■ Donotattempttodisassembleanyburnerwhileanother
burner is on. Damage to the product may occur.
■ Besuretheburnersandgratesarecoolbeforeyou
place your hand, a pot holder or cleaning materials
on them.
Your rangetop has sealed gas burners that offer
convenience, cleanability and flexibility for a wide range
of cooking applications.
The smallest burner is the simmer burner. A simmer
burner turned down to LO provides precise cooking
performance for foods such as delicate sauces that
require low heat for a long cooking time.
Selecting a Flame Size
Watch the flame, not the knob, as you adjust heat. When
rapid heating is desired, the flame size should match the
size of the cookware you are using. Flames larger than
the bottom of the cookware will not heat faster and may
be hazardous.
Pushthecontrolknobinand
turn it to the LITE position.
These flames are too large for the pot

849-2001073 Rev. 1
USING THE RANGE: Surface Burners
Surface Burners (Cont.)
Stove Top Grills
Do not use an after-market stove top grill on your
gas surface burners. A stove top grill will cause
incomplete combustion resulting in carbon monoxide
levels above allowable standards. This could be
hazardous to your health.
Using a Wok
Use only a flat-bottomed wok with a diameter of 14 inches
or less. Make sure the wok bottom sits flat on the grate.
Donotuseawoksupportring.Placingtheringoverthe
burner or grate may cause the burner to work improperly,
resulting in carbon monoxide levels above allowable
standards. This could be hazardous to your health. Use a flat-bottomed wok.
Do not use stove top grills
Top-of-Range Cookware
Aluminum: Medium-weight cookware is recommended
because it heats quickly and evenly. Most foods brown
evenly in an aluminum skillet. Use saucepans with tight-
fitting lids when cooking with minimum amounts of water.
Stainless Steel: This metal alone has poor heating
properties and is usually combined with copper,
aluminum or other metals for improved heat distribution.
Combination metal skillets usually work satisfactorily if
they are used with medium heat or as the manufacturer
recommends.
Cast-Iron: If heated slowly, most skillets will give
satisfactory results.
Enamelware: Under some conditions, the enamel
of some cookware may melt. Follow the cookware
manufacturer’s recommendations for cooking methods.
Glass:Therearetwotypesofglasscookware—those
for oven use only and those for top-of-range cooking
(saucepans,coffeeandteapots).Glassconductsheat
very slowly.
Heatproof Glass Ceramic: Can be used for either
surface or oven cooking. It conducts heat very slowly and
cools very slowly. Check the cookware manufacturer’s
directions to be sure it can be used on gas ranges.

49-2001073 Rev. 1 9
Oven Controls
Sabbath Mode
USING THE OVEN:OvenControls/SabbathMode
Oven Temperature Knob
Turn the Oven Temp knob to the setting you want.
■OnmodelsthatdonothaveanOven/Cyclelight,
preheat the oven for 10 minutes for baking.
■TheOven/Cyclelightcomesonwhentheburneris
on(onsomemodels).Itwillcycleonandoffduring
cooking.
To Adjust the Thermostat:
1. PulltheOven Temp knob off the range and look
at the back side. To make an adjustment, loosen
(approximatelyoneturn),butdonotcompletely
remove, the two screws on the back of the knob.
2. With the back of the knob facing you, hold the outer
edge of the knob with one hand and with the other
hand rotate the skirt.
Rotate the skirt counterclockwise to increase and
clockwise to decrease the oven temperature. You’ll
hear a click for each notch you move the knob.
Each click will change the oven temperature
approximately10°F.(Rangeisplusorminus
30°Ffromthearrow.)Wesuggestthatyoumake
the adjustment one click from the original setting
and check oven performance before making any
additional adjustments.
3. After the adjustment is made, retighten screws so
they are snug, but be careful not to overtighten.
4. Replace the knob, matching the flat area of the knob
to the shaft, and check performance.
Do not use thermometers, such as those found in
grocery stores, to check the temperature setting of your
oven. These thermometers may vary 20-40 degrees.
FrontofOVENTEMPknob(knobappearancemayvary)
2
6
0
3
0
0
3
5
0
4
0
0
4
5
0
5
0
0
B
R
O
I
L
OVEN TEMP
O
F
F
Certain models comply with Jewish Sabbath requirements for use during the Sabbath and holidays.
Start Baking
To start baking, simply turn the thermostat knob to the
desired temperature. Because a thermostat model will
respond with a clicking sound when the thermostat knob
is used to turn on the oven, this operation should take
place before the Sabbath or Holidays begin.
Adjusting the Temperature
To adjust the oven temperature while in compliance with
Sabbath requirements, the user must observe the oven
ON indicator light:
■Toadjusttheoventemperaturetoahighervalue,
the user must first confirm the "OVEN ON" light is
on. Only then, can the user turn the knob to a higher
temperature than was previously set.
■
To adjust the oven temperature to a lower value, the user
must first confirm the "OVEN ON" light is off. Only then,
can the user turn the knob to a lower temperature than
was previously set.
Stop Baking
To stop baking, simply turn the thermostat knob to the off
position. Because a thermostat model will respond with a
clicking sound when the thermostat knob is used to turn
off the oven, this operation should take place after the
Sabbath or Holidays end.
Oven Light Operation (on some models)
The oven light can be set to either on or off prior to the
start of the Sabbath or the holiday. Opening and closing
of the door will not change the state of the oven light.
Sabbath Mode Power Outage Note
If a power outage occurs during a Sabbath bake, the unit
will return to Sabbath bake mode when power is restored
and the oven will return to the same temperature as
before the outage, without any intervention from the user.
BackofOVENTEMPknob
Counterclockwise to
Increase Temperature
(Shownathighestsetting)
Clockwise to Decrease
Temperature
(Shownatlowestsetting)
Skirt(OutsideRing)

10 49-2001073 Rev. 1
The material, finish, and size of cookware affect baking
performance.
Dark, coated and dull pans absorb heat more readily
thanlight,shinypans.Pansthatabsorbheatmore
readily can result in a browner, crisper and thicker crust.
If using dark and coated cookware check food earlier
than the minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
oven temperature by 25º F next time.
■ Shinypanscanproducemoreevenlycookedbaked
goods such as cakes and cookies.
■ Glassandceramicpansheatslowlybutretainheat
well. These types of pans work well for dishes such
as pies and custards.
■ Airinsulatedpansheatslowlyandcanreducebottom
browning.
■ Keepcookwarecleantopromoteevenheating.
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Cooking Guide section for recommendations for specific foods. Remember, your new oven may perform
differently than the oven it is replacing.
Bake
The bake mode is for baking and roasting. When
preparing baked goods such as cakes, cookies and
pastries, always preheat the oven first. To use this mode
turn the thermostat knob to the desired temperature.
Warm (on some models)
Warm mode is designed to keep hot foods hot. Cover
foods that need to remain moist and do not cover foods
thatshouldbecrisp.Preheatingisnotrequired.Donot
use Warm to heat cold food. It is recommended that food
not be kept warm for more than 2 hours. To use this
mode turn the thermostat knob to Warm.
Broil
Always broil with the oven door and drawer closed.
Monitor food closely while broiling. Use caution when
broiling on the upper rack positions as placing food
closer to the broil burner increases smoking, splattering,
and the possibility of fats igniting.
Try broiling foods that you would normally grill. Adjust
rack positions to adjust the intensity of the heat to the
food.Placefoodsclosertothebroilburnerwhena
seared surface and rare interior is desired. Thicker foods
and foods that need to be cooked through should be
broiled on a lower rack position. To use this mode turn
the thermostat knob to the Broil setting. NOTE: Remove
unused racks from oven for faster preheat, improved
efficiency, and optimal performance.
Broil Compartment (on some models)
For better searing use the rack position that places
food closest to the broil heater. Move food down for
moredoneness/lesssearing.Takecarenottotouch
the inner door when placing and removing food in broil
compartment.
Cookware Guidelines
Cooking Modes
USING THE OVEN: CCookwareGuidelines/CookingModes
Broil Compartment
Oven Cavity

49-2001073 Rev. 1 11
Rack Positions
Your oven has four rack positions in the main oven.
Recommended rack positions for various types of
foods are provided in the Cooking Guide. Adjusting
the rack position is one way to impact cooking results.
For example, if you would prefer darker tops on cakes,
muffins or cookies, try moving food one rack position
higher. If you find foods are too brown on top, try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is sufficient space between pans to allow
air to flow. This may improve cooking evenness.
Removing and Replacing Flat Racks
When placing and removing cookware, pull the rack out
tothebump(stopposition)ontheracksupport.
To remove a rack, pull it toward you until it reaches the
stop position, tilt up the front of the rack and pull it out.
To replace a rack, place the curved end of the rack onto
the rack supports. Tilt up the front of the rack and push
the rack in until it stops. Then lay the rack flat and push
it in until it is all the way into the oven.
Racks may become difficult to slide, especially after a
self-clean cycle. To improve sliding conditions, use a soft
cloth or paper towel to rub vegetable oil on the left and
rightedgesoftheracksand/orracksupports.
NOTE: Remove unused racks when using the oven for
faster preheat, improved efficiency, and optimal cooking
performance.
Neverblockthevents(airopenings)oftherange.They
provide the air inlet and outlet that are necessary for the
range to keep cool and operate properly with correct
combustion.
Air openings are located at the rear of the cooktop, at
the top and bottom of the oven door, and at the bottom
of the range.
CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foil may be used to catch spills by placing a sheet on a lower rack, several inches below the food. Do not use more
foilthannecessaryandneverentirelycoveranovenrackwithaluminumfoil.Keepfoilatleast1-1/2”fromovenwalls
to prevent poor heat circulation.
Rack positions
Removing racks
Replacing racks
Rack stop
position
Oven Racks
Oven Air Vents
Aluminum Foil and Oven Liners
USING THE OVEN:OvenRacks/OvenAirVents/AluminumFoilandOvenLiners
Vent appearance and location vary.

12 49-2001073 Rev. 1
FOOD TYPE
RECOMMENDED
MODE(S)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer cakes, sheet cakes,
bundt cakes, muffins, quick
breads on a Single Rack
Bake 3 Use shiny cookware.
Layer cakes* on Multiple
Racks Bake 2 and 4 Ensure adequate airflow
(seeillustrationbelow).
Chiffoncakes(angelfood) Bake 2 Use shiny cookware.
Cookies, biscuits, scones on
a Single Rack Bake 3 Use shiny cookware.
Cookies, biscuits, scones on
Multiple Racks Bake 2 and 4 Ensure adequate airflow. Switch food location partially
through cooking for more even cooking results.
Beef & Pork
Hamburgers Broil 4 or C
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling.
Center food under burner.
Steaks & Chops Broil 4 or C
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling.
Center food under burner.
Roasts Bake 2 or 3 Leave uncovered, use a low sided pan such
asabroilpan.Preheatingisnotnecessary.
Poultry
Whole chicken Bake 2 Leave uncovered, use a low sided pan
such as a broil pan.
Bone-in chicken breasts, legs,
thighs
Broil
Bake
3 or A
2 or 3
If breaded or coated in sauce avoid Broil modes. Broil
skin side down first. Watch food closely when broiling.
Boneless chicken breasts Broil
Bake
3 or A
2 or 3
Movefooddownformoredoneness/lesssearingand
upforgreatersearing/browningwhenbroiling.
Whole turkey Bake 1 or 2 Leave uncovered, use a low sided pan
such as a broil pan.
Turkey Breast Bake 2 or 3 Leave uncovered, use a low sided pan
such as a broil pan.
Fish Broil 4 Watch food closely when broiling.
Casseroles Bake 3
Frozen Convenience Foods
Pizza,potatoproducts,
chicken nuggets, appetizers
on a Single Rack
Bake 4 Use shiny cookware.
*When baking four cake layers at a time, stagger the
pans as shown to the right so that one pan is not directly
above another.
Cook food thoroughly to help protect against
foodborne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov. Make sure to use a food thermometer
to take food temperatures.
NOTE: Remove unused racks when using the oven for
faster preheat, improved efficiency and optimal cooking
performance.
RearPlacement
FrontPlacement
Rack positions
Cooking Guide
USING THE OVEN: Cooking Guide

49-2001073 Rev. 1 13
Oven Exterior
Do not use oven cleaners, abrasive cleansers, strong
liquid cleansers, steel wool, plastic scouring pads or
cleaning powders on the interior or exterior of the oven.
Cleanwithamildsoapandwaterora50/50solutionof
vinegar and water. Rinse with clean water and dry with a
soft cloth. When cleaning surfaces, make sure that they
are at room temperature and not in direct sunlight.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up as soon as hot surfaces cool,
then clean and rinse.
Oven Racks
All oven racks may be cleaned by hand with an abrasive
cleaner or steel wool.
After cleaning the racks, use a soft cloth or paper towel
to rub a small amount of vegetable oil on the left and
right edges of the rack. This will ensure the racks are
easy to slide in and out of the oven
Oven
CARE AND CLEANING: Oven
Be sure all controls are off and all surfaces are cool before cleaning any part of the oven.
Oven Interior
The interior of your new oven can be cleaned manually
or by using steam clean process.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up as soon as hot surfaces cool,
then clean and rinse.
Manual Cleaning
Do not use oven cleaners, strong liquid cleansers, steel
wool, or scouring pads on the interior of the oven. For
soils on the oven bottom and other enameled surfaces,
use a gentle abrasive containing oxalic acid, such as
BarKeepersFriend®, with a non-scratch sponge. Take
care not to apply any abrasive cleaners or sponges to
the door glass, as it will scratch the reflective coating.
The oven interior and door glass may be cleaned using
a soft cloth with a mild soap and water, or vinegar and
water solution. After cleaning, rinse with clean water and
dry with a soft cloth.
Steam Cleaning
Steam Cleaning is for cleaning light soil from your oven.
To use the Steam Clean feature:
1. Start with the oven at room temperature.
2. Wipe excess grease and soils from the oven.
3.Pour1/2cupofwaterontothebottomoftheoven.
4. Close the door.
5. Turn your oven temperature knob to 200ºF.
6.Setatimerfor21/2minutes.Whentimeisfinish,
turn oven temperature knob to Off.
7. Set a timer for 27 minutes to allow oven to cool
down.
Do not open the door during the Steam Cleaning. At the
end of the cycle, soak up the remaining water, and wipe
the moisture-softened soil from the oven walls and door.

14 49-2001073 Rev. 1
Cooktop
CARE AND CLEANING: Cooktop
Cooktop Surface
Do not use oven cleaners, abrasive cleansers, strong
liquid cleansers, steel wool, plastic scouring pads, or
cleaning powders on the cooktop surface. Clean with a
mildsoapandwaterora50/50solutionofvinegarand
water. Rinse with clean water and dry with a soft cloth.
When cleaning surfaces, make sure that they are at
room temperature and not in direct sunlight.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up as soon as hot surfaces cool,
then clean and rinse.
If your model has a stainless steel cooktop surface,
refer to the Stainless Steel Surface cleaning instructions
featuredintheControlPanelandKnobssection.
Control Panel and Knobs
Wipe the control panel after each use of the oven with
a damp cloth. For cleaning, use mild soap and water or
a50/50solutionofvinegarandwater.Rinsewithclean
water.Polishdrywithasoftcloth.
Do not use abrasive cleansers, strong liquid cleansers,
plastic scouring pads or oven cleaners on the control
panel—theywilldamagethefinish.
Stainless Steel Surfaces (on some models)
Do not use a steel wool pad; it will scratch the surface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
CleanerswithoxalicacidsuchasBarKeepersFriendSoft
Cleanser™ will remove surface rust, tarnish and small
blemishes. Use only a liquid cleanser free of grit and rub in
the direction of the brush lines with a damp, soft sponge.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end
of this manual.
For easier cleaning, the control knobs may be removed
by pulling them directly outwards once the knobs are in
the OFF position. Do not pull knobs up or down or hang
objects on them. This can damage the gas valve shaft.
Whenremovingthetri-ring(onsomemodels)andthe
dual-oval(onsomemodels)burnerknobs,remember
their location. While all other knobs are interchangeable,
these knobs must be placed in the same location after
cleaning. See the Surface Burner section for a detailed
view of these knobs. The knobs can be washed by hand
with soap and water or in a dishwasher.
To replace knobs after cleaning, align the hole on
the knob backside with the gas valve shaft and push
inward until the knob is securely fastened. All knobs are
interchangeable
Surface burner knob
Removal of Surface Burners for Cleaning
Turn all controls OFF. Allow cooktop to cool before
removing grates and burner parts. When removing the
burner caps and heads, remember their size and location.
Replace them in the same location after cleaning.
Round Burner
Round Burner Cap
(Removable)
Electrode
Round
Burner
Head

49-2001073 Rev. 1 15
Burner Grates
Grates should be washed in hot, soapy water and rinsed with clean water. To soften burned-on food, place grates in a
solution containing ¼-cup of household ammonia for several hours. Afterward, scrub grates with a plastic scouring pad
soaked in hot, soapy water. Rinse well and dry.
Cooktop (Cont.)
CARE AND CLEANING: Cooktop
Burner cap is
properly seated.
Burner cap is
NOT properly
seated.
Burner cap is
NOT properly
seated.
Cleaning the Surface Burners
Cleaning the Burner Caps
Wash burner caps in hot, soapy water and rinse with
clean water. You may scour with a plastic scouring pad
to remove burned-on food particles. The round burner
caps may also be cleaned in your dishwasher.
Cleaning the Burner Heads
Wash the burner heads routinely, especially after bad
spillovers which could clog the burner openings. Lift
burners off when cool. Wash with hot, soapy water.
Rinse with clean water. For more stubborn stains, use a
brush with plastic bristles.
NOTE: Do not use steel wool or scouring pads to clean
the burner parts as these may clog the openings. Never
wash burner heads in your dishwasher as dishwasher.
Doing so may cause them to discolor.
The ports in the burner heads must be kept clean at all
times for an even, unhampered flame.
Clogged or dirty burner ports or electrodes will not allow
the burner to operate properly.
Replacing Surface Burners
Before replacingtheburnercaps,headsandovalhead/
cap assembly, shake out excess water and allow them to
dry thoroughly.
Replace burner heads in the correct locations according
to size. Ensure each cap is properly seated on the
burner head, as pictured below.
CAUTION Do not operate the cooktop without
all burner parts and grates in place.
Any spill on or around an electrode must be carefully
cleaned. Avoid hitting the electrode with anything hard or
it could be damaged.
The electrode of the spark igniter is exposed
when the burner head is removed. When one
burner is turned to LITE, all the burners spark.
Do not attempt to disassemble or clean around
any burner while another burner is on.
Electrode

16 49-2001073 Rev. 1
Door and Drawer
Cleaning the Oven Door
Cleaning the Door Interior
Do not allow excess water to run into any holes or slots
in the door.
Wipe dish soap over any baked-on spatters on the glass.
Use a single sided safety razor blade to clean it off. Then
wipe over the glass with a soapy cloth to remove any
residue and dry off.
The area outside the gasket can be cleaned with a soap-
filled plastic scouring pad. Do not rub or clean the door
gasket - it has an extremely low resistance to abrasion.
If you notice the gasket becoming worn, frayed or
damaged in any way or if it has become displaced on the
door, you should have it replaced.
Cleaning the Door Exterior
If a stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Do not use this method on any other surface.
Stainless Steel Surfaces (on some models)
Do not use a steel wool pad; it will scratch the surface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always
wipe the surface in the direction of the grain. Follow
the cleaner instructions for cleaning the stainless steel
surface.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end
of this manual.
CARE AND CLEANING: DoorandDrawer/OvenLight
WARNING
SHOCK OR BURN HAZARD: Before replacing oven light bulb, disconnect the electrical power to the
range at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn.
CAUTION BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with
bare hands or a damp cloth can cause burns.
Oven Light (on some models)
Removable Storage Drawer (on some models)
The storage drawer is a good place to store cookware
and bakeware. Do not store plastics or flammable
material in the drawer.
The storage drawer may be removed for cleaning under
the range. Clean the storage drawer with a damp cloth or
sponge. Never use harsh abrasives or scouring pads.
Yourstoragedrawermayhaveplasticslides(shownto
theright)ormetalrails.Followtherespectiveremovaland
replacement instructions for your model’s configuration.
Removing the Storage Drawer:
1. Pulldrawerstraightoutuntilitstops.
2. Continue to pull the drawer until it is detached from
the oven.
Replacing the Storage Drawer:
1. Rest the left drawer rail around the inner left rail guide
and slide it in slightly.
2. Placetherightdrawerrailaroundtheinnerrightrail
guide and slide it in slightly.
2. Slide the drawer all the way in.
Oven Light Replacement
Be sure to let the light cover and bulb cool completely.
To remove the cover:
1. Hold a hand under the cover so it doesn’t fall when
released. With fingers of the same hand, firmly push
back the wire cover holder. Lift off the cover.
Do not remove any screws to remove the cover.
2. Replace bulb with a 40-watt appliance bulb.
To replace the cover:
1. Placeitintogrooveofthelightreceptacle.Pullwire
forward to the center of the cover until it snaps into place.
2. Connect electrical power to the range.
Wire cover holder

49-2001073 Rev. 1 17
Oven Door
The door is very heavy. Be careful when removing and lifting the door. Do not lift door by the handle.
To Remove the Door:
1. Fully open the door.
2. Pullthehingelocksupandawayfromtherange
frame to the unlocked position.
3. Firmly grasp both sides of the door near the top.
4. Close door until the top of the door is approximately
6”fromtherangeframe.
5. Lift door up and away from the range until both hinge
arms are clear of the slots in the range frame.
To Replace the Door:
1. Firmly grasp both sides of the door near the top.
2. With the door at the same angle as the removal
position, rest the notch on the underside of the left
hinge arm on the bottom edge of the left hinge slot.
The notch in the hinge arm must be fully seated into
the bottom of the slot. Repeat for the right side.
3. Fully open the door. If the door will not fully open, the
notches in the bottoms of the hinge arms have not
seated correctly in the bottom edge of the slot. Lift the
door off the range and repeat previous step.
4. Pushthehingelockstowardtherangecavityand
down to the locked position.
5. Close the oven door.
CARE AND CLEANING: Oven Door
Removal position
Pullhingelocksuptounlock
PushhingelocksdowntolockRest notch on bottom edge
of hinge slot
Notch
Bottom
edge of
slot
Hinge arm

18 49-2001073 Rev. 1
Problem Possible Cause What To Do
My new oven
doesn't cook like
my old one. Is
something wrong
with the temperature
settings?
Your new oven has a different cooking
system from your old oven and therefore
may cook differently than your old oven.
For the first few uses, follow your recipe times
and temperatures carefully and use rack positions
recommended in the Cooking Guide. If you still think
your new oven is too hot or too cold, you can adjust
the temperature yourself to meet your specific cooking
preference. See the Oven Controls section.
Food does not bake
properly
Oven controls improperly set. See the Cooking Modes section.
Rack position is incorrect or rack is not
level.
See the Cooking Modes section and Cooking Guide.
Incorrect cookware or cookware of
improper size being used.
See the Cookware section.
Oven temperature needs adjustment. See the Oven Controls section.
Food does not broil
properly
Oven controls improperly set. Make sure you select the appropriate broil mode.
Improper rack position being used. See Cooking Guide for rack location suggestions.
Cookware not suited for broiling. Use a pan specifically designed for broiling.
Aluminum foil on the broil pan has not
been fitted properly or slit to drain grease.
If using aluminum foil on broil pan, wrap tightly and add slits
conforming to those in the pan to allow grease to drain.
Oven temperature
too hot or too cold
Oven temperature needs adjustment. See the Oven Controls section.
Oven appears not to
work
A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Oven controls improperly set. See the Using the Oven section.
Oven is in Sabbath Mode. Verify, that the oven is not in Sabbath Mode. See the
Sabbath Mode section.
“Crackling” or
“popping” sound
This is the sound of the metal heating
and cooling during both the cooking and
cleaning functions.
This is normal.
Why is my range
making a "clicking"
noise when using
my oven?
Your range has been designed to
maintain a tighter control over your oven's
temperature. You may hear your oven's
heating elements "click" on and off more
frequently than in older ovens to achieve
better results during baking, broiling, and
self-clean cycles.
This is normal.
Sometimes the oven
takes longer to
preheat to the same
temperature
Cookware,food,and/ornumberofracks
in oven.
Cookware, food, and racks in the oven will cause
differences in preheat times. Remove excess items to
reduce preheat time.
Oven light does not
work
Light bulb is loose or defective. Tighten or replace bulb. See the Oven Light section for
instructions on how to replace the bulb.
Save time and money! Review the charts on the following pages first and you may not need to call for service.
TROUBLESHOOTING TIPS
Troubleshooting Tips ... Before you call for service

49-2001073 Rev. 1 19
Troubleshooting Tips ... Before you call for service
TROUBLESHOOTING TIPS
Problem Possible Cause What To Do
Burners do not light Plugonrangeisnotcompletelyinsertedin
the electrical outlet.
Make sure electrical plug is plugged into a live, properly
grounded outlet.
Gas supply not connected or turned on. See the Installation Instructions that came with your
range.
A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Burner parts not replaced correctly. See the Care and Cleaning of the range section.
Burner slots near the electrode may be
clogged.
Remove the burners and clean them. Check the electrode
area for burned-on food or grease. See the Care and
Cleaning of the range section.
Food residue on electrode Lightly polish flat tip of electrode with nail file or
sandpaper until shiny.
Top burners do not
burn evenly
Improper burner assembly. Make sure the burner caps are seated correctly. See the
Care and Cleaning of the range section.
Burner slots on the side of the burner may
be clogged.
Remove the burners for cleaning. See the Care and
Cleaning of the range section.
Burner flames are
very large or yellow
Improper air to gas ratio. IfrangeisconnectedtoPropanegas,contactthe
technician who installed your range or made the
conversion.
Surface burners
light but bake and
broil burners do not.
Gas to the oven burners may have been
shut off.
The oven gas shut-off is located on the gas regulator near
the gas line attachment to your range. Locate it and flip
the lever.
My oven door glass
appears to be
"tinted" or have a
"rainbow" color.
The inner oven glass is coated with a heat
barrier to reflect the heat back into the
oven to prevent heat loss and keep the
outer door cool while baking.
This is normal. Under certain light or angles, you may see
this tint or rainbow color.
Drawer does not
slide smoothly or
drags
The drawer is out of alignment. Fully extend the drawer and push it all the way in. See the
Care and Cleaning of the range section.
Drawer is over-loaded or load is
unbalanced.
Reduce weight or redistribute drawer contents.
Lever is
shown closed.
PULLTOOPEN.
Sealed burner models

20 49-2001073 Rev. 1
Notes
This manual suits for next models
4
Table of contents
Other GE Range manuals
Popular Range manuals by other brands

Frigidaire
Frigidaire FEF357ASB Wiring diagram

Smeg
Smeg CX68CM8 manual

DeLonghi
DeLonghi Electric Range DEGLSC 24 SS installation instructions

Town Food Service Equipment
Town Food Service Equipment Chinese Wok owner's manual

Kenmore
Kenmore c970-44096 Use & care guide

Thor Kitchen
Thor Kitchen HRG48 Series user manual