GE PSS93 User manual

Write the model and serial
numbers here:
Model #_________________
Serial # _________________
You can find them on a label
behind the door or drawer.
OWNER’S MANUAL
RANGES
Electric Front Control
49-2000723 Rev. 0 02-20 GEA
30" Front Control Range
PSS93
GE is a trademark of the General Electric Company. Manufactured under trademark license.
SAFETY INFORMATION .......... 3
USING THE RANGE
Surface Units ........................... 7
Cookware for Radiant Glass Cooktop......10
Oven Controls ..........................11
Cooking Options........................12
Settings ...............................13
Sabbath Mode..........................14
Oven Racks ............................15
Aluminum Foil and Oven Liners...........16
Cookware..............................16
Cooking Modes .........................16
Oven Probe ............................18
Cooking Guide .........................19
CARE AND CLEANING
Cleaning the Range – Exterior ...........20
Cleaning the Range – Interior ............21
Cleaning the Glass Cooktop ............. 22
Oven Probe ........................... 23
Oven Light............................24
Soft Close Drawer ..................... 25
TROUBLESHOOTING TIPS.......26
LIMITED WARRANTY ............30
ACCESSORIES .....................31
CONSUMER SUPPORT ........... 32

249-2000723 Rev. 0
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.

49-2000723 Rev. 0 3
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
ANTI-TIP DEVICE
To reduce the risk of tipping the range,
the range must be secured by a properly
installed anti-tip bracket. See installation
instructions shipped with the bracket for
complete details before attempting to install.
For Free-Standing and Slide-In Ranges
To check if the bracket is installed and
engaged properly, look underneath the
range to see that the rear leveling leg is
engaged in the bracket. On some models, the storage drawer or kick panel
can be removed for easy inspection. If visual inspection is not possible,
slide the range forward, confirm the anti-tip bracket is securely attached to
the floor or wall, and slide the range back so the rear leveling leg is under
the anti-tip bracket.
If the range is pulled from the wall for any reason, always repeat this
procedure to verify the range is properly secured by the anti-tip bracket.
Never completely remove the leveling legs or the range will not be secured
to the anti-tip device properly.
WARNING Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
• A child or adult can tip the range and be killed.
• Install the anti-tip bracket to the wall or floor.
•
Engage the range to the anti-tip bracket by sliding the
range back such that the foot is engaged.
• Re-engage the anti-tip bracket if the range is moved.
• Failure to do so can result in death or serious burns
to children or adults.
Tip-Over Hazard
WARNING
Anti-Tip
Bracket
Leveling Leg
Free-Standing and Slide-In Ranges
WARNING GENERAL SAFETY INSTRUCTIONS
■ Usethisapplianceonlyforitsintendedpurposeas
described in this Owner’s Manual.
■ Besureyourapplianceisproperlyinstalledand
grounded by a qualified installer in accordance with
the provided installation instructions.
■ Donotattempttorepairorreplaceanypartofyour
range unless it is specifically recommended in this
manual. All other servicing should be transferred to
a qualified technician.
■ Beforeperforminganyservice,unplugtherange
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
■ Donotleavechildrenalone—childrenshouldnot
be left alone or unattended in an area where an
appliance is in use. They should never be allowed
to climb, sit or stand on any part of the appliance.
■ CAUTION Donotstoreitemsofinterestto
children above a range or on the backguard of a
range—childrenclimbingontherangetoreach
items could be seriously injured.
■ Useonlydrypotholders—moistordamppot
holders on hot surfaces may result in burns from
steam.Donotletpotholderstouchhotsurface
unitsorheatingelements.Donotuseatowelor
other bulky cloth in place of pot holders.
■ Neveruseyourapplianceforwarmingorheating
the room.
■ Donottouchthesurfaceunits,theheatingelements
or the interior surface of the oven. These surfaces
may be hot enough to burn even though they are
darkincolor.Duringandafteruse,donottouch,
or let clothing or other flammable materials contact
the surface units, areas nearby the surface units or
any interior area of the oven; allow sufficient time
for cooling first. Other surfaces of the appliance
may become hot enough to cause burns. Potentially
hot surfaces include the cooktop, areas facing the
cooktop, oven vent opening, surfaces near the
opening and crevices around the oven door.
■ Donotheatunopenedfoodcontainers.Pressure
could build up and the container could burst,
causing an injury.

449-2000723 Rev. 0
WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
Failure to do so may result in fire or personal injury.
■ Donotstoreoruseflammablematerialsinanoven
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
■ Neverwearloose-fittingorhanginggarmentswhile
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
■ Donotletcookinggreaseorotherflammable
materials accumulate in or near the range. Grease in
the oven or on the cooktop may ignite.
■ Cleanventilatinghoodsfrequently.Greaseshould
not be allowed to accumulate on the hood or filter.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
■ Donotusewaterongreasefires.Neverpickupa
flaming pan. Turn the controls off. Smother a flaming
pan on a surface unit by covering the pan completely
withawell-fittinglid,cookiesheetorflattray.Use
a multi-purpose dry chemical or foam-type fire
extinguisher.
■ Ifthereisafireintheovenduringbaking,smother
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
■ Ifthereisafireintheoven,turntheovenoffand
wait for the fire to go out. Donotforcethedooropen.
Introduction of fresh air at self-clean temperatures
may lead to a burst of flame from the oven. Failure to
follow this instruction may result in severe burns.
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING COOKTOP SAFETY INSTRUCTIONS
■ Neverleavethesurfaceunitsunattendedatmedium
or high heat settings. Boilovers cause smoking and
greasy spillovers that may catch on fire.
■ Neverleaveoilunattendedwhilefrying.Ifallowed
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
cabinets.Useadeepfatthermometerwhenever
possible to monitor oil temperature.
■ Toavoidoilspilloverandfire,useaminimum
amount of oil when shallow pan-frying and avoid
cooking frozen foods with excessive amounts of ice.
■ Onlycertaintypesofglass,glass/ceramic,
earthenware or other glazed containers are suitable
for cooktop service; others may break because of the
sudden change in temperature.
■ Tominimizethepossibilityofburns,ignitionof
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby surface units.
■ Whenpreparingflamingfoodsunderahood,turnthe
fan on.
■ Useproperpansize—selectcookwarehaving
flat bottoms large enough to cover the surface
heating element. The use of undersized cookware
will expose a portion of the surface unit to direct
contact and may result in ignition of clothing. Proper
relationship of cookware to surface unit will also
improve efficiency.
WARNING GENERAL SAFETY INSTRUCTIONS (Cont.)
■ Donotuseanytypeoffoilorlinertocovertheoven
bottom or anywhere in the oven, except as described
in this manual. Oven liners can trap heat or melt,
resulting in damage to the product and risk of shock,
smoke or fire.
■ Avoidscratchingorimpactingglassdoors,cook
topsorcontrolpanels.Doingsomayleadtoglass
breakage.Donotcookonaproductwithbroken
glass. Shock, fire or cuts may occur.
■ Cookmeatandpoultrythoroughly—meattoatleast
an internal temperature of 160°F and poultry to at
least an internal temperature of 180°F. Cooking
to these temperatures usually protects against
foodborne illness.
■ Cookfoodthoroughlytohelpprotectagainst
foodborne illness. Minimum safe food temperature
recommendations can be found at IsItDoneYet.gov
and fsis.usda.gov.Useafoodthermometertotake
food temperatures and check several locations.

49-2000723 Rev. 0 5
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING RADIANT COOKTOP SAFETY INSTRUCTIONS
■ Usecarewhentouchingthecooktop.Theglass
surface of the cooktop will retain heat after the
controls have been turned off.
■ Donotcookonabrokencooktop.Ifglasscooktop
should break, cleaning solutions and spillovers
may penetrate the broken cooktop and create a
risk of electric shock. Contact a qualified technician
immediately.
■ Avoidscratchingtheglasscooktop.Thecooktop
can be scratched with items such as knives, sharp
instruments, rings or other jewelry, and rivets on
clothing.
■ Useaceramiccooktopcleanerandnon-scratching
cleaning pad to clean the cooktop. Wait until the
cooktop cools and the indicator light goes out
before cleaning. A wet sponge or cloth on a hot
surface can cause steam burns. Some cleaners can
produce noxious fumes if applied to a hot surface.
NOTE: Sugar spills are an exception. They should
be scraped off while still hot using an oven mitt
and a scraper. See the Cleaning the glass cooktop
section for detailed instructions.
■ Readandfollowallinstructionsandwarningsonthe
cleaning cream label.
■ Donotplaceorstoreitemsthatcanmeltorcatch
fire on the glass cooktop, even when it is not being
used. If the cooktop is inadvertently turned on, they
may ignite. Heat from the cooktop or oven vent after
it is turned off may cause them to ignite also.
■ Ifpowerislosttoanelectriccooktopwhilea
surface unit is ON, the surface unit will turn back on
as soon as power is restored. In the event of power
loss, failure to turn all surface unit knobs to the OFF
position may result in ignition of items on or near
the cooktop, leading to serious injury or death.
WARNING OVEN SAFETY INSTRUCTIONS
■ Standawayfromtherangewhenopeningtheoven
door. Hot air or steam which escapes can cause
burnstohands,faceand/oreyes.
■ Donotusetheovenifaheatingelementdevelops
a glowing spot during use or shows other signs
of damage. A glowing spot indicates the heating
element may fail and present a potential burn, fire,
or shock hazard. Turn the oven off immediately and
have the heating element replaced by a qualified
service technician.
■ Keeptheovenventunobstructed.
■ Keeptheovenfreefromgreasebuildup.Greasein
the oven may ignite.
■ Placeovenracksindesiredlocationwhileovenis
cool. If rack must be moved while oven is hot, do not
let pot holder contact hot heating element in oven.
■ Whenusingcookingorroastingbagsintheoven,
follow the manufacturer’s directions.
■ Pulltheovenracktothestop-lockpositionwhen
loading and unloading food from the oven. This
helps prevent burns from touching hot surfaces of
the door and oven walls.
■ Donotleaveitemssuchaspaper,cookingutensils
or food in the oven when not in use. Items stored in
an oven can ignite.
■ Neverplacecookingutensils,pizzaorbakingstones,
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.

649-2000723 Rev. 0
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface.Donotuseanysharpitemstoremovethefilm.
Remove all of the film before using the appliance for the
first time.w
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WiFi Enable Equipment
This device complies with part 15 of the FCC Rules.
Operation is subject to the following two conditions: (1)
This device may not cause harmful interference, and
(2) this device must accept any interference received,
including interference that may cause undesired operation.
The wireless communication equipment installed on this
range has been tested and found to comply with the
limits for a Class B digital device, pursuant to part 15 of
the FCC Rules. These limits are designed to:
(a) provide reasonable protection against harmful
interference in a residential installation. This equipment
generates, uses, and can radiate radio frequency energy
and, if not installed and used in accordance with the
instructions, may cause harmful interference to radio
communications. However, there is no guarantee that
interference will not occur in a particular installation. If
this equipment does cause harmful interference to radio
or television reception, which can be determined by
turning the equipment off and on, the user is encouraged
to try to correct the interference by one or more of the
following measures:
■Reorientorrelocatethereceivingantenna.
■Increasetheseparationbetweentheequipmentand
receiver.
■Connecttheequipmentintoanoutletonacircuit
different from that to which the receiver is connected.
■Consultthedealeroranexperiencedradio/TV
technician for help.
(b) accept any interference received, including interference
that may cause undesired operation of the device.
Note that any changes or modifications to the wireless
communication device installed on this oven that are not
expressly approved by the manufacturer could void the
user’s authority to operate the equipment.

49-2000723 Rev. 0 7
Surface Units
USING THE RANGE:SurfaceUnits
Operating the Cooktop Elements
WARNING FIRE HAZARD: Never leave the
range unattended with the cooktop on. Keep
flammable items away from the cooktop. Turn off all
controls when done cooking. Failure to follow these
instructions can result in fire, serious injury or death.
Before using the cooktop for the first time, clean it with
ceramic cooktop cleaner. This helps protect the top and
makes cleanup easier.
Turn element(s) On: Touch and hold On/Off pad about
half a second. A chime can be heard with each touch to
any pad.
Power level can be selected in any of the following ways:
1. Swipe the gray arc (on the graphics) to the desired
power level. There is no sensor on the LEDs, or;
2. Touch Anywhere along the gray arc, or;
3. Touch +or -pads to adjust power level, or;
4. Shortcut to Hi: Immediately after turning unit on, touch
the +pad, or;
5. Shortcut to Low: Immediately after turning unit on,
touch the -pad.
NOTE: When changing from a high heat setting to a
lower heat setting, the surface unit may stop glowing.
This is normal. The unit is still on and hot.
NOTE: This cooktop has a rapid heat-up feature. If the
cooktop is cool when turned on, it will glow red for a short
period of time until the desired power setting is reached.
Gray Arc
Swipe Area
LED
Lights
Gray Arc Swipe Area

849-2000723 Rev. 0
USING THE RANGE:SurfaceUnits
Surface Units
Using the Warming Zone
WARNING
FOOD POISON HAZARD: Bacteria may grow in food at
temperatures below 140°F.
■ Alwaysstartwithhotfood.Donotusewarmsettingto
heat cold food.
■ Donotusewarmsettingformorethan2hours.
The WARMING ZONE, located in the back center of
the glass surface, will keep hot, cooked food at serving
temperature.Alwaysstartwithhotfood.Donotuseto
heat cold food. Placing uncooked or cold food on the
WARMING ZONE could result in foodborne illness.
To use the WARMING ZONE:
Press the WARMING ZONE pad, select the desired level
(1, 2 or 3) using the number pads, and press start.
To turn off the WARMING ZONE:
Press the WARMING ZONE pad.
NOTE: Cancel/OffwillNOTturnoffthewarmingzone.
For best results, all foods on the WARMING ZONE
should be covered with a lid or aluminum foil. When
warming pastries or breads, the cover should be vented
to allow moisture to escape.
The initial temperature, type and amount of food, type of
pan, and the time held will affect the quality of the food.
Always use pot holders or oven mitts when removing
food from the WARMING ZONE, since cookware and
plates will be hot.
NOTE: The surface warmer will not glow red.
How To Synchronize Left Elements
Multi-Ring Burner (Can be Dual or Triple)
To Turn On
Hold the Sync Burners pad for about half a second to
connect the two elements. Operate either element as
described in Operating the Cooktop Elements to adjust
power level.
To Turn Off
1. Touch the On/Off pad on either element to turn off
the Sync Burners.
2. Touch the Sync Burners to turn both elements off.
To Turn On/Off
1. Touch the On/Off pad for the right front surface unit.
2. Usethearcor+or –pad to choose the desired
power setting.
3. Touch the Burner Size pad as needed to select the
desired burner size.
The light next to the Burner Size pad indicates which
size the surface unit is on. To turn the surface unit off,
touch the On/Off pad.

49-2000723 Rev. 0 9
Surface Units (Cont.)
USING THE RANGE:SurfaceUnits
Home Canning Tips
Be sure the canner is centered over the surface unit.
Make sure the canner is flat on the bottom.
To prevent burns from steam or heat, use caution when
canning.
Userecipesandproceduresfromreputablesources.
These are available from manufacturers such as Ball®
andKerr®andtheDepartmentofAgricultureExtension
Service.
Flat-bottomedcannersarerecommended.Useofwater
bath canners with rippled bottoms may extend the time
required to bring the water to a boil.
Temperature Limiter on Radiant Glass Cooktops
Every radiant surface unit has a temperature limiter.
The temperature limiter protects the glass cooktop from
getting too hot.
The temperature limiter may cycle the surface units off
for a time if:
■ thepanboilsdry.
■ thepanbottomisnotflat.
■ thepanisoff-center.
■ thereisnopanontheunit.
Radiant Glass Cooktop
The radiant cooktop features heating units beneath a
smooth glass surface.
NOTE: A slight odor is normal when a new cooktop is
used for the first time. It is caused by the heating of new
parts and insulating materials and will disappear in a
short time.
NOTE: On models with light-colored glass cooktops, it is
normal for the cooking zones to change color when hot
or cooling down. This is temporary and will disappear as
the glass cools to room temperature.
The surface unit will cycle on and off to maintain your
selected control setting.
It is safe to place hot cookware on the glass surface
even when the cooktop is cool.
Even after the surface units are turned off, the glass
cooktop retains enough heat to continue cooking. To
avoid overcooking, remove pans from the surface units
when the food is cooked. Avoid placing anything on the
surface unit until it has cooled completely.
■ Waterstains(mineraldeposits)areremovableusing
the cleaning cream or full-strength white vinegar.
■ Useofwindowcleanermayleaveaniridescentfilmon
the cooktop. The cleaning cream will remove this film.
■ Don’tstoreheavyitemsabovethecooktop.Ifthey
drop onto the cooktop, they can cause damage.
■ Donotusethesurfaceasacuttingboard.
Never cook directly on the glass. Always
use cookware.
Always place the pan in the center of the
surface unit you are cooking on.
Donotslidecookwareacrossthecooktopbecause
itcanscratchtheglass—theglassisscratch-
resistant, not scratch proof.

10 49-2000723 Rev. 0
Cookware for Radiant Glass Cooktop
The following information will help you choose cookware which will give good performance on glass cooktops.
NOTE: Follow all cookware manufacturer’s recommendations when using any type of cookware on the ceramic cooktop.
Recommended
Stainless Steel
Aluminum:
heavy weight recommended
Good conductivity. Aluminum residues
sometimes appear as scratches on the
cooktop but can be removed if cleaned
immediately. Because of its low melting
point, thin weight aluminum should not
be used.
Copper Bottom:
Copper may leave residues which can
appear as scratches. The residues can
be removed, as long as the cooktop
is cleaned immediately. However, do
not let these pots boil dry. Overheated
metal can bond to glass cooktops. An
overheated copper bottom pot will leave
a residue that will permanently stain the
cooktop if not removed immediately.
Enamel (painted) on Cast Iron:
recommended if bottom of pan is coated
Avoid/Not Recommended
Enamel (painted) on Steel:
Heating empty pans can cause
permanent damage to cooktop glass.
The enamel can melt and bond to the
ceramic cooktop.
Glass-ceramic:
Poor performance. Will scratch the
surface.
Stoneware:
Poor performance. May scratch the
surface.
Cast Iron:
notrecommended—unlessdesigned
specifically for glass cooktops
Poor conductivity and slow to absorb
heat. Will scratch the cooktop surface.
Check pans for flat bottoms by
using a straight edge.
Pans with rounded, curved,
ridged or warped bottoms are
not recommended.
For Best Results
■ Placeonlydrypansonthesurfaceelements.Donot
place lids on the surface elements, particularly wet lids.
Wet pans and lids may stick to the surface when cool.
■ Donotusewoksthathavesupportrings.Thistypeof
wok will not heat on glass surface elements.
■ Werecommendthatyouuseonlyaflat-bottomed
wok. They are available at your local retail store. The
bottom of the wok should have the same diameter as
the surface element to ensure proper contact.
■ Somespecialcookingproceduresrequirespecific
cookware such as pressure cookers or deep-fat
fryers. All cookware must have flat bottoms and be
the correct size.
Donotplacewetpansontheglasscooktop.
Donotusewokswithsupportringsontheglasscooktop.
Useflat-bottomedwoksontheglasscooktop.
USING THE RANGE: Cookware for Radiant Glass Cooktop

49-2000723 Rev. 0 11
USING THE RANGE: Oven Controls
1. Traditional Cooking Modes: Your oven
has the following traditional cooking modes: Bake,
Broil, and Warm. See the Cooking Modes section
for more information.
2. Convection Cooking Modes: Convection
cooking modes use increased air circulation to
improve performance. See the Cooking Modes
section for more information.
3. Air Fry: See the Cooking Modes section for more
information about this special convection mode.
4. Steam Clean: See the Cleaning the Oven
section for important information about using these
modes.
5. Start/Enter: Must be pressed to start any
cooking, cleaning, or timed function. Also used to
start the Warming Zone on the cooktop.
6. Cancel/Off: Cancels ALL oven operations
excepttheclockandtimer.DoesNOTcancelthe
Warming Zone on the cooktop.
7. Timer: Works as a countdown timer. Press the
Timer pad and number pads to program the time in
hours and minutes. Press the Start pad. The timer
countdown is complete. To turn the timer off press
the Timer pad.
8. Oven Light: Turns the oven light on or off.
9. Lock Controls: Locks out the control so that
pressing the pads does not activate the controls.
Press and hold the Lock Controls pad, for three
seconds to lock or unlock the control. Cancel/Off is
always active, even when the control is locked.
10. Cooking Options and Settings: The
Cooking Options and Settings pads open up more
detailed menus in the display that allow access to
additional functions and cooking modes. For each
you select the function in the display using the
associated number pad. You can exit at any time
by pressing the Cooking Options or Settings pad
again. See the Settings, Cooking Options, and
Cooking Modes Sections for more details.
Oven Controls
56
9
7
9 10
3
1
2
8
4

12 49-2000723 Rev. 0
USING THE RANGE:CookingOptions/Settings
Cooking Options
The Cooking Options pad opens up a menu of more cooking modes when the oven is off. It opens a menu with
additional features if a cooking mode is already in process. You can exit the menu at any time by pressing the
Cooking Options pad again.
You must first select an oven and a mode (bake, convection bake, convection roast) and then select Cooking
Options to get to the following functions.
Cook Time
Counts down cooking time and turns off the oven when
the cooking time is complete. Select a desired cooking
mode.Usethenumberpadstoprogramabaking
temperature. Press the Cooking Options pad and
select Cook Time.Usethenumberpadtoprogram
cook time in hours and minutes. Then press Start/Enter.
This can only be used with Bake, Convection Bake, and
Convection Roast.
Delay Time
Delayswhentheovenwillturnon.Usethistoseta
time when you want the oven to start. Press the desired
cookingmodepad.Usethenumberpadtoprograma
baking temperature. Press the Cooking Options pad
and select Delay Time.Usethenumberpadstoprogram
the time of day for the oven to turn on, and then press
Start/Enter.DelayTimeisnotavailablewithallmodes.
NOTE:WhenusingtheDelayTimefeature,foodsthat
spoil easily – such as milk, eggs, fish, stuffing, poultry,
and port – should not be allowed to sit for more than
1 hour before or after cooking. Room temperature
promotes the growth of harmful bacteria. Be sure that the
oven light is off because heat from the bulb will speed
harmful bacteria growth.
Oven Probe
NOTE: Only accessible through traditional and
convection cooking modes.
Monitors internal food temperature and turns the oven
off when the food reaches the programmed temperature.
Insert the probe, press the desired cooking mode, and
program the probe temperature. See the Cooking Modes
Section for more information. The probe can only be used
with Bake, Convection Bake, and Convection Roast.
Settings
The Cooking Options and Settings pads open up more detailed menus in the display that allow access to
additional functions. For each you select the function in the display using the associated number pad. You
can exit at any time by pressing the Cooking Options or Settings pad again.
WiFi Connect/Remote Enable
Your oven is designed to provide you with two-way
communication between your appliance and smart
device. By using the WiFi Connect features, you will
be able to control essential oven operations such as
temperature settings, timers and cooking modes using
your smartphone or tablet.*
Select Settings then Wifi - follow the instructions on your
oven display and phone app. It is necessary to turn on
WiFi before using Remote Enable on your oven.
Connecting your WiFi Connect Enabled Oven
What you will need
Your GE Appliances oven uses your existing home WiFi
network to communicate between the appliance and
your smart device. In order to setup your GE Appliances
oven, you will need to gather some information:
1. Each GE Appliances oven has a connected appliance
information label that includes an Appliance Network
Name and Password. These are the two important
details that you will need to connect to the appliance.
The label is typically located inside the door of the
oven or drawer.
2. Have your smart phone or tablet ready with the ability
to access the internet and download apps.
3. You will need to know the password of your home
WiFi router. Have this password ready while you are
setting up your GE Appliances oven.
Connect your GE Appliances oven
1. On your smart phone or tablet visit
Geappliances.ca/Connect to learn more about
connected appliance features and to download the
appropriate app.
2. Follow the app onscreen instructions to connect your
GE Appliances oven.
3. Once the process is complete, the connection light
located on your GE Appliances oven display will stay
on solid and the app will confirm you are connected.
FCC: ZKJ-WCATA001 Network: GE_XXXXXX_XXXX
Password: XXXXXXXX
PT. NO. 229C6272G001-0
IC: 10229A-WCATA001
MAC ID: XX - XX - XX - XX - XX - XX
Connected Appliance Information
Sample Label

49-2000723 Rev. 0 13
* Compatible Apple or Android devices and home WiFi network required.
USING THE RANGE: Settings
Settings
Wifi Connect (cont.)
4. If the connection light does not turn on or is blinking,
follow the instructions on the app to reconnect. If
issues continue, please call the Connected Call
Center 1.800.220.6899 and ask for assistance
regarding oven wireless connectivity.
To connect additional smart devices, repeat steps 1 and 2.
Note that any changes or modifications to the remote
enable device installed on this oven that are not
expressly approved by the manufacturer could void the
user’s authority to operate the equipment.
REMOTE STARTING YOUR OVEN
To be able to start the oven remotely once connected to
WiFi, press the Remote Enable pad and the icon will
turn on in the display. The oven can now be remotely
started with a connected device. Opening an oven door
or turning off the oven will turn off the icon. The
icon must be lit to start the oven remotely. The icon
is not required to change the oven temperature while it
is running, set a timer or to turn the oven off from the
phone app while the icon shows it is Wifi Connected.
After using the oven, remember to verify that the icon
is lit if you wish to start the oven remotely in the future.
NOTE: Foodsthatspoileasily—suchasmilk,eggs,fish,
stuffings,poultryandpork—shouldnotbeallowedto
sit for more than 1 hour before or after cooking. Room
temperature promotes the growth of harmful bacteria. Be
sure that the oven light is off because heat from the bulb
will speed harmful bacteria growth.
Clock
This setting sets the oven clock time. Press the Settings
pad, select More and then select Set Clock. Follow the
instructions to set the clock. This feature also specifies
how the time of day will be displayed. You can select
a standard 12-hour clock (12H), 24-hour military time
display (24H), or no clock displayed (Off). Press the
Settings pad, select Set Clock and select either 12/24
hr or On/Off.
Bluetooth®- Chef Connect
This is a pairing feature for use with other compatible
Chef Connect enabled products like an over-the-range
microwave oven or range hood. To pair those products to
the range Press the Settings pad and select Bluetooth®.
Select Pair and follow the corresponding instructions
included with the mating Chef Connect enabled product.
The range will cancel pairing mode after two minutes if
no mating device is detected. Select Remove to confirm
product is paired or to un-pair from range.
Auto Conv (Auto Conversion)
When using Convection Bake cooking, Auto Recipe
Conversion will automatically convert the regular baking
temperatures entered to convection bake cooking
temperatures when turned on. Note that this option does
not convert convection bake cooking times, it only converts
temperatures. This feature may be turned On or Off.
Press
the Settings pad, select More and then select
Auto
Conversion. Follow the prompts to turn this feature on or
off.
Auto Off
This feature shuts the oven down after 12 hours of
continuous operation. It may be enabled or disabled.
Select Settings, More, and Auto Off to turn this feature
on or off.
Sound
You can adjust the volume and type of alert your appliance
uses. Select Settings, More, and Sound. Follow prompts
for making volume adjustments or for changing between
continuous and single alert tones. A continuous setting will
continue to sound a tone until a button on the control is
pressed. The oven tone volume can be adjusted between
several settings and off. The control will sound the oven
tone at the new volume level each time the sound level is
changed.
F/C (Fahrenheit or Celsius)
The oven control is set to use Fahrenheit temperatures
(F), but you can change it to use Celsius temperatures
(C). Select Settings, More, and F/C to alter between
temperature scales displayed.
Adjust the Oven temperature
This feature allows the oven cooking modes to be
adjustedupto35ºFhotterordownto35ºFcooler.Use
this feature if you believe your oven temperature is too
hot or too cold and wish to change it. This adjustment
affects Bake and Convection Bake modes. No other
cooking modes are affected. Press the Settings pad,
select More and then select Oven Adjust to add More
Heat or Less Heat. Press Save.
Oven Info
To display the model number and software version on
your unit, select Settings, More, and Oven Info.

14 49-2000723 Rev. 0
USING THE RANGE: Sabbath Mode
TheSabbathmodefeaturecomplieswithstandardssetforthbyStarK.Someofthesestandardsthatwillbenoticed
by the consumer include the disabling of tones, disabling of oven lights, and delays of about 30 seconds to one
minute on display changes. Only continuous baking or timed baking is allowed in the Sabbath mode. Cooking in the
Sabbath mode is a two-step process, first the Sabbath mode must be set and then the bake mode must be set.
Setting the Sabbath Mode
Press the Settings pad, select Sabbath, and select
Turn on. A single bracket “]” will appear in the display
indicating that the Sabbath mode is set. The clock will not
be displayed. Continuous bake or timed bake can now be
programmed.
Starting a Continuous Bake
1. Press the Bake pad.
2. If the desired temperature is 350F, press Start/
Enter. If a different cooking temperature is desired,
use the 1through 5number pads to select a preset
cooking temperature, then press Start/Enter. Refer
to the graphic below to determine which pad sets the
desired cooking temperature.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking.
Adjusting the Temperature
Press Bake, use the 1through 5number pads to select
a different preset cooking temperature, and press Start/
Enter.
Starting a Timed Bake
1. Press the Bake pad.
2. If the desired temperature is 350F, use the 6through
0number pads to select a cooking time. If a cooking
temperature other than 350F is desired, use the 1
through 5number pads to select a preset cooking
temperature, then select the cooking time. Refer to
the graphic on this page to determine which pad sets
the desired cooking temperature and cooking time.
3. Press Start/Enter.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking. When the cook
time expires, the display will change back to a single
bracket “]” indicating that the oven is no longer baking.
No tone will sound when the cook time is complete.
Exit the Sabbath Mode
Exiting the Sabbath mode should be done after the
Sabbath is over.
1. Press Cancel/Off to end any bake mode that may be
running.
2. Press and hold Settings pad until Sabbath Mode off
is displayed.
Sabbath Mode Power Outage Note
If a power outage occurs while the oven is in Sabbath
Mode, the unit will return to Sabbath Mode when power
is restored, however the oven will return to the off state
even if it was in the middle of a bake cycle when the
power outage occurred.
Sabbath Mode
Temperature (°F)
Time (hours)
200
325
2.5h
250
400
3h
4h
300
2h
3.5h
1 = 200° F, 2 = 250° F, 3 = 300° F, 4 = 325° F, 5 = 400° F
6 = 2 hours, 7 = 2.5 hours, 8 = 3 hours, 9 = 3.5 hours, 0 = 4 hours

49-2000723 Rev. 0 15
Recommended rack positions for various types of
foods are provided in the Cooking Guide. Adjusting
rack position is one way to impact cooking results. For
example, if you would prefer darker tops on cakes,
muffins, or cookies, try moving food one rack position
higher. If you find foods are too brown on top try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is at least 1½" between pans to allow
sufficient space for air to flow.
To avoid possible burns, place the racks in the desired
position before you turn the oven on.
Extension Racks
Always pull the rack out by its upper front rail to its fully
open position, when placing or removing cookware.
Extension racks cannot be used in the top rack position.
If extension racks are difficult to extend, lubricate the
racks with the graphite lubricant provided with your
oven. Remove the rack from the oven, remove debris in
the side tracks with a paper towel, shake the graphite
lubricant and place 4 small drops on the two bottom
tracks of the left and right sides. Open and close the
rack several times to distribute the lubricant.
To order additional graphite lubricant, read the
Accessories section of the manual.
To Remove An Extension Rack:
1. Make sure the rack is pushed all the way into the oven
so that side paddles on the rack disengage from the
oven support.
2. Slide the rack toward you to the bump (stop position)
on the rack support.
3. Firmly grasp both sides of the rack frame and the
sliding rack, tilt the front end up and pull it out.
To Replace An Extension Rack:
1. Firmly grasp both sides of the rack frame and the
sliding rack.
2. Place the curved end of the rack (stop-locks) onto
the oven supports, tilt up the front of the rack and
push it in as far as it will go.
If extension racks are difficult to replace or remove, wipe
theovenracksupportswithvegetableoil.Donotwipeoil
on the rack slides.
NOTE: Usingothercookingoilswillcauseadiscoloring
or a rust like color residue on the racks and cavity sides.
To clean this residue, use a soap and water or a vinegar
and water solution. Rinse with clean water and dry with
a soft cloth.
To Lubricate the Paddle:
Shake lubricant and apply to the moving parts of the
paddle mechanisms as shown.
USING THE RANGE: Oven Racks
Oven Racks
The number of rack positions may vary by model.
UpperFront
Rail
Fully Open Position
Grasp here

16 49-2000723 Rev. 0
USING THE RANGE:AluminumFoilandOvenLiners/Cookware
Cookware
Cookware Guidelines
The material, finish, and size of cookware affect baking
performance.
Dark,coatedanddullpansabsorbheatmorereadily
than light, shiny pans. Pans that absorb heat more
readily can result in a browner, crisper, and thicker crust.
If using dark and coated cookware check food earlier
than minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
oven temperature by 25ºF next time.
Shiny pans can produce more evenly cooked baked
goods such as cakes and cookies.
Glass and ceramic pans heat slowly but retain heat well.
These types of pans work well for dishes such as pies
and custards.
Air insulated pans heat slowly and can reduce bottom
browning.
Keepcookwarecleantopromoteevenheating.
CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foilmaybeusedtocatchspillsbyplacingasheetonalowerrack,severalinchesbelowthefood.Donotusemore
foilthannecessaryandneverentirelycoveranovenrackwithaluminumfoil.Keepfoilatleast1-1/2”fromovenwalls
to prevent poor heat circulation.
Aluminum Foil and Oven Liners
Cooking Modes
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Cooking Guide section for rack position and other recommendations for specific modes and foods.
Bake
The bake mode is for baking and roasting. When
preparing baked goods such as cakes, cookies and
pastries, always preheat the oven first. To use this
mode press the Bake pad, enter a temperature with the
number pads, and then press Start/Enter.
Warm
Warm mode is designed to keep hot foods hot. Cover
foods that need to remain moist and do not cover foods
thatshouldbecrisp.Preheatingisnotrequired.Do
not use warm to heat cold food It is recommended that
food not be kept warm for more than 2 hours. Press the
Warm pad and then press Start/Enter.
Air Fry Cookware
Any cookware used on Air Fry mode should be broil
safe. A dark surface, solid baking pan with low rimmed
sides, such as a sheet pan, is recommended for use
with Air Fry. The darker pan surface promotes better
browning and crisping.
Oven baking baskets and baking grids can also be used,
but a sheet pan should be placed on the rack below the
foods to catch any drippings when using a baking basket. Primary recommended cookware
Alternate cookware options

49-2000723 Rev. 0 17
Broiling Modes
Always broil with the oven door closed. Monitor food
closelywhilebroiling.Usecautionwhenbroiling:placing
food close to the broil element increases smoking,
spattering and the possibility of fats igniting. It is not
necessary to preheat when using the Broil modes.
Broil Hi
The Broil Hi mode uses intense heat from the upper
elementtosearfoods.UseBroilHiforthinnercuts
ofmeatand/orwhenyouwouldliketohaveaseared
surface and rare interior. To use this mode press the
Broil pad once and then press Start/Enter.
Broil Lo
The Broil Lo mode uses less intense heat from the upper
element to cook food thoroughly while also browning the
surface.UseBroilLoforthickercutsofmeatand/orfoods
that you would like cooked all the way through. To use
this mode press the Broil pad twice and then press
Start/Enter.
Frozen - Snacks
The Frozen Snacks modes are designed to cook frozen
foods such as potato nuggets, French fries, and similar
frozen snacks and appetizers. Most foods will cook
within package recommended time. Adjust cooking time
according to individual preferences.
UseFrozenSnacksSinglewhencookingfrozensnacks
on a single rack. This mode does not require preheating
the oven. Food should be placed in the oven before or
immediately upon starting this mode.
UseFrozenSnacksMultiwhencookingfrozensnacks
on two racks simultaneously. This mode includes a
preheating cycle to prepare the oven for multi-rack
baking. Press Options and select Frozen then follow any
display prompts to access this mode.
Frozen - Pizza
The Frozen Pizza modes are designed to cook
frozen pizzas. Most pizzas will cook within package
recommended times. Adjust cooking time according to
individual preferences.
UseFrozenPizzaSinglewhencookingonasinglerack.
This mode does not require preheating the oven. Food
should be placed in the oven before or immediately upon
starting this mode.
UseFrozenPizzaMultiwhencookingontworacks
simultaneously. This mode includes a preheating cycle
to prepare the oven for multi-rack baking. Press Options
and select Frozen then follow any display prompts to
access this mode.
Baked Goods
The Baked Goods mode is designed for cooking cakes,
breads, cookies, and similar foods on a single rack. This
mode is designed to provide lighter top browning and
better volume. Some foods may require slightly longer
cook times relative to when cooked in the traditional bake
mode. Press Options and select Baked Goods than
follow any display prompts to access this mode.
Convection Bake
The Convection Bake mode is intended for baking
on multiple racks at the same time. This mode uses
air movement from the convection fan to enhance
cooking evenness. Your oven is equipped with Auto
Recipe Conversion, so it is not necessary to adjust the
temperature when using this mode. Always preheat
when using this mode. Baking times may be slightly
longer for multiple racks than what would be expected
for a single rack. To use this mode press the Conv Bake
pad, enter a temperature with number pads, and then
press Start/Enter.
Convection Roast
The Convection Roast mode is intended for roasting
whole cuts of meat on a single rack. This mode uses
movement from the convection fan to improve browning
and reduce cooking time. It is not necessary to convert
temperature. Check food earlier than the recipe suggested
time when using this mode, or use the probe. To use this
mode press the Conv Roast pad, enter a temperature
with the number pads, and then press Start/Enter.
Proof
Proof mode maintains a warm environment for rising
yeast-leavened dough.
If the oven is too warm, Proof mode will not operate and
the display will show "Oven too hot for Proof".
For best results, cover the dough while proofing and
check early to avoid over-proofing.
CAUTION DonotusetheProofmodeforwarming
food or keeping food hot. The proofing oven temperature
is not hot enough to hold foods at safe temperatures.
Air Fry
This mode is a special convection mode that is designed
to produce foods with a crispier exterior than traditional
oven cooking. The Air Fry mode uses hot, fast-moving
air and is intended for single rack baking only. Press Air
Fry, then input the desired set temperature and press
Start. The temperature can be set between 300°F and
500°F. Preheating is not necessary for this mode. Follow
recipe or package guidelines for set temperatures and
cook times; adjust cook time to achieve your desired
crispness. Additional guidelines for using this mode can
be found in the Cooking Guide.
Cooking Modes (Cont.)
USING THE RANGE: Cooking Modes

18 49-2000723 Rev. 0
Internal food temperature is frequently used as an
indicator of doneness, especially for roasts and poultry.
The Probe mode monitors the internal food temperature
and turns the oven off when the internal food
temperature reaches the programmed temperature.
Always check the temperature at multiple locations in
the food with a food thermometer after cooking to ensure
that all portions of the food have reached the minimum
safe internal temperature for that food.
Proper Probe Placement
After preparing the meat and placing it on the cooking
pan follow these instructions for proper probe placement.
■ Inserttheprobeintothefood,sothatthetipofthe
probe will rest in the center of the thickest part of
the food. For best performance the probe should
be fully inserted into the food. If the probe is not
located properly, it may not accurately measure the
temperature of the coolest portion of the food. Some
foods, particularly small items, are not well suited for
cooking with the probe due to their shape or size.
■ Theprobeshouldnottouchbone,fatorgristle.
■ Forwholepoultryinserttheprobeintothethickest
part of the breast.
■ Forbonelessroasts,inserttheprobeintothecenter
of the roast.
■ Forbone-inhamorlamb,inserttheprobeintothe
center of the lowest large muscle or joint.
■ Forcasserolesordishessuchasmeatloaf,insertthe
probe into the center of the dish.
■ Forfish,inserttheprobefromjustabovethegillinto
the meatiest area, parallel to the backbone.
Probe Usage
The temperature probe can only be used with Bake,
Convection Bake, and Convection Roast
To use the probe with preheating:
1. Press the desired cook mode (Bake, Convection
Bake, or Convection Roast) pad and enter the
desired cooking temperature with the number pads.
2. Insert the probe into the food (see Proper Probe
Placement).
3. Once the oven is preheated, place the food in the
oven and connect the probe to the probe outlet,
makingsureitisfullyinserted.Usecaution,theoven
walls and probe outlet are hot.
4. When the probe is connected, the display will prompt
you to enter the desired food temperature. The
maximum internal food temperature that you can set
is 200° F.
To use the probe without preheating:
1. Insert the probe into the food (see Proper Probe
Placement).
2. Place the food in the oven and connect the probe into
the probe outlet in the oven.
3. Press the Cook Mode pad (Traditional Bake,
Convection Bake, or Convection Roast) and enter the
desired cooking temperature with the number pads.
Press Cooking Options and select Probe then
follow the display prompts to enter the desired food
temperature.
Probe Care Guidelines
■ Useofprobesotherthantheoneprovidedwiththis
product may result in damage to the probe outlet.
■ Usethehandlesoftheprobeandplugwheninserting
and removing them from the meat and outlet
■ Toavoiddamagingyourprobe,donotusetongsto
pull on the cable when removing it.
■ Toavoidbreakingtheprobe,makesurefoodis
completely defrosted before inserting the probe.
■ Topreventpossibleburns,donotunplugtheprobe
from the outlet until the oven has cooled.
■ Neverleavetheprobeinsidetheovenduringasteam
clean cycle.
■ Donotstoretheprobeintheoven.
Oven Probe
WARNING
Consuming undercooked food can result in foodborne illness. Use probe according to
the following instructions to ensure all portions of the food reach minimum safe cooking temperatures.
Recommendations for minimum safe food temperatures can be found at foodsafety.gov or IsItDoneYet.gov.
USING THE RANGE: Oven Probe

49-2000723 Rev. 0 19
USING THE RANGE: Cooking Guide
FOOD TYPE
RECOMMENDED
MODE(S)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer Cakes, sheet cakes,
bundt cakes, muffins, quick
breads on a Single Rack
Bake 3 Useshinycookware.
Baked Goods 3
Layer cakes* on Multiple
Racks
Bake
Convection Bake 2 and 4 Ensure adequate airflow
(see illustration below).
Chiffon cakes (angel food) Baked Goods 1 Useshinycookware.
Cookies, biscuits, scones on
a Single Rack
Bake 3 Useshinycookware.
Baked Goods 3
Cookies, biscuits, scones on
Multiple Racks Convection Bake 2 and 4 Ensure adequate airflow.
Yeast Breads
Proof 2 or 3 Cover dough loosely
Bake 3
Baked Goods 3
Beef & Pork
Hamburgers Broil High 6
Useabroilpan;movefooddownformoredoneness/lesssearing.Watch
food closely when broiling. For best performance center food below the
broil heating element
Steaks & Chops Broil High 5 or 6
Useabroilpan;movefooddownformoredoneness/lesssearing.Watch
food closely when broiling. For best performance center food below the
broil heating element
Roasts Bake
Convection Roast 2 or 3 Usealowsidedpansuchasabroilpan.Preheatingisnotnecessary
Poultry
Whole chicken Bake
Convection Roast 2 or 3 Usealowsidedpansuchasabroilpan.
Bone-in chicken breasts,
legs, thighs
Broil Low
Bake 3
If breaded or coated in sauce avoid Broil Hi modes. Broil skin side down
first. Watch food closely when broiling. For best performance when
broiling, center food below the broil heating element.
Boneless chicken breasts Broil Low
Bake 3
If breaded or coated in sauce avoid Broil Hi modes. Broil skin side down
first. Watch food closely when broiling. For best performance when
broiling, center food below the broil heating element
Whole turkey Bake
Convection Roast 1Usealowsidedpansuchasabroilpan.
Turkey Breast Bake
Convection Roast 3Usealowsidedpansuchasabroilpan.
Fish Broil Low 6(1/2thickorless)
5(>1/2inch)
Watch food closely when broiling. For best performance center food below the
broil heating element.
Casseroles Bake 3 or 4
Frozen Convenience Foods
Pizza on a single rack Frozen Pizza Single 3Donotpreheat.
Pizza on multiple racks Frozen Pizza Multi 2 and 4 Stagger pizzas left to right, do not place directly over each other
Potato products, chicken
nuggets, appetizers on a
single rack
Frozen Snacks Single
Air Fry
4 or 5
4
Donotpreheat.Usedarkcookwareformorebrowning/crisping;useshiny
cookware for less browning.
Potato products, chicken
nuggets, appetizers on
multiple racks
Frozen Snacks Multi 2 and 4 Usedarkcookwareformorebrowning/crisping;useshinycookwarefor
less browning.
*When baking four cake layers at a time, use racks
2 and 4.
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov.Useafoodthermometertotake
food temperatures.
Cooking Guide
Baking four cake layers at a time
Rear Placement
Front Placement

20 49-2000723 Rev. 0
Cleaning the Range – Exterior
A child or adult can tip the range and be killed.
Verify the anti-tip bracket has been properly installed
and engaged.
Ensure the anti-tip bracket is re-engaged when the range
is moved.
Do not operate the range without the anti-tip bracket in
place and engaged.
Failure to follow these instructions can result in death or
serious burns to children or adults.
Tip-Over Hazard
WARNING
WARNING If your range is removed for cleaning, servicing or any reason, be sure the
anti-tip device is reengaged properly when the range is replaced. Failure to
take this precaution could result in tipping of the range and can result in death
or serious burns to children or adults.
Be sure all controls are off and all surfaces are cool before cleaning any part of the range.
Control Lockout
If desired, the touch pads may be deactivated before
cleaning.
See Lock Controls in the Oven Controls section in this
manual.
Clean up splatters with a damp cloth.
You may also use a glass cleaner.
Removeheaviersoilwithwarm,soapywater.Donotuse
abrasives of any kind.
Reactivate the touch pads after cleaning.
Control Panel
It’s a good idea to wipe the control panel after each use.
Clean with mild soap and water or vinegar and water,
rinse with clean water and polish dry with a soft cloth.
Donotuseabrasivecleansers,strongliquidcleansers,
plastic scouring pads or oven cleaners on the control
panel—theywilldamagethefinish,includingBlack
Stainless Steel.
Oven Exterior
Donotuseovencleaners,abrasivecleansers,strong
liquid cleansers, steel wool, plastic scouring pads, or
cleaning powders on the interior or exterior of the oven.
Clean with a mild soap and water or vinegar and water
solution. Rinse with clean water and dry with a soft cloth.
When cleaning surfaces, make sure that they are at
room temperature and not in direct sunlight.
If stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up immediately. Let hot surfaces
cool, then clean and rinse.
Painted Surfaces and Black Stainless Steel
Painted surfaces include the sides of the range and the
door, top of control panel and the drawer front. Clean
these with soap and water or a vinegar and water solution.
Donotusecommercialovencleaners,cleaning
powders, steel wool or harsh abrasives on any painted
surface, including Black Stainless Steel.
Stainless Steel - Excluding Black Stainless Steel (on some models)
Donotuseasteelwoolpad;itwillscratchthesurface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end
of this manual.
USING THE RANGE: Cleaning the Range – Exterior
This manual suits for next models
1
Table of contents
Languages:
Other GE Range manuals

GE
GE JGB770SEFSS Manual

GE
GE JGBP33DEMWW User manual

GE
GE JGSP20 User manual

GE
GE PB920TPWW - Profile 30" Electric Ran How to use

GE
GE 164D3333P150 User manual

GE
GE Cafe CGS990SETSS Manual

GE
GE Profile JS905TKWW Manual

GE
GE Profile J2S968 SERIES User manual

GE
GE PCGB910 Original instructions

GE
GE JGBS07PEAWW Manual