Nordyne MB7BM Series User manual
MODULAR AIR HANDLER
MB7BM, MB7EM, & MB7VM SERIES
INSTALLATION INSTRUCTIONS
DO NOT DESTROY. PLEASE READ CAREFULLY & KEEP IN A SAFE PLACE FOR FUTURE REFERENCE.
IMPORTANT
ATTENTION INSTALLERS:
It is your responsibility to know this product better than your customer.This includes being
abletoinstalltheproductaccording to strictsafetyguidelinesandinstructingthecustomer on
how to operate and maintain the equipment for the life of the product.Safety should always be
the deciding factor when installing this product and using common sense plays an important
role as well.Pay attention to all safety warnings and any other special notes highlighted in the
manual. Improper installation of the furnace or failure to follow safety warnings could result
in serious injury, death, or property damage.
Please read all instructions carefully before starting the installation. These instructions are
primarily intended to assist qualified individuals experienced in the proper installation of this
appliance. Some local codes require licensed installation / service personnel for this type of
equipment. If a problem occurs, check the instructions and follow recommendations given.
If these suggestions don’t eliminate your problem, call your servicing contractor. Return this
manual to the customer’s package for future reference.
2
IMPORTANT SAFETY INFORMATION .......................3
GENERAL INFORMATION..........................................3
Requirements & Codes.............................................3
About the Air Handler................................................3
BeforeYou Install this Equipment..............................4
Minimum Clearances.................................................4
Locating the Air Handler............................................4
Operation of an Air Handler During Construction......4
Plenums & Air Ducts .................................................5
Supply Air Connections..........................................5
Return Air Connections..........................................5
Acoustical Duct Work.............................................5
Air Filters................................................................6
Unconditioned Spaces...........................................6
Condensate Drainage ..............................................6
AIR HANDLER INSTALLATION..................................6
Upflow Installation.....................................................6
Downflow Installation.................................................7
Horizontal Installation................................................8
Horizontal Left Installations....................................8
Horizontal Right Installations .................................8
ELECTRICAL CONNECTIONS...................................9
Pre-Electrical Checklist .............................................9
Line Voltage...............................................................9
Thermostat Connections...........................................9
Control Board..........................................................10
Twinning...............................................................10
Heater Kits...............................................................10
Electronic Air Cleaner..............................................10
Humidifier................................................................10
Optional Humidistat.................................................10
Grounding................................................................10
STARTUP & ADJUSTMENTS ...................................11
BeforeYou Start the Air Handler..............................11
Air Circulation Check...............................................11
Running the Blower Continuously........................11
System Cooling....................................................11
System Heating....................................................11
Turning the Blower Off..........................................11
Blower Configurations .............................................11
Selecting minimum Electric Heat Airflow..............11
Determining Nominal System Capacity ...............11
3-speed Units.......................................................11
High Efficiency Units............................................12
Selecting Basic Heating Airflow...........................12
Selecting Basic Cooling/Heat Pump Airflow.........12
Dehumidification Options ........................................12
UNIT MAINTENANCE................................................13
TROUBLESHOOTING ...............................................13
FIGURES &TABLES .................................................14
Figure 7. MB7 Series Dimensions........................14
Figure 8. MB7 Series Components......................15
Blower Performance Data .......................................16
Table 4. MB7BM Airflow Data...............................16
Table 5. MB7EM Airflow Data...............................17
Table 6. MB7EM Airflow Settings (Heat Only)......18
Table 7. MB7VM Airflow Settings (Cool Only)......18
Table 8. MB7VM Airflow Data...............................19
Electrical Data & Diagrams .....................................20
Table 9. MCA & MOP Data...................................20
Figure 9.Typical T-Stat Connections....................21
Figure 10. Single Stg. C.B. (MB7BM)...................22
Figure 11. Single Stg. C.B. MB7(EM & VM)..........22
Figure 12.Two Stg. Fixed Sp. M.C.B. (EM)...........23
Figure 13.Two Stg.Var. Sp. M.C.B. (VM)..............23
Figure 14.Wiring Diagram (BM Models)..............24
Figure 15.Wiring Diagram (EM Models)..............25
Figure 16.Wiring Diagram (VM Models)..............26
Table 10. MB7BM Heating Element Logic............27
Table 11. MB7(EM & VM) Heat Element Logic.....28
INSTALLATION / PERFORMANCE CHECKLIST.....32
TABLE OF CONTENTS
3
IMPORTANT SAFETY INFORMATION
Please read all information in this manual thoroughly
and become familiar with the capabilities and use of this
appliancebeforeattemptingtoserviceormaintainthisunit.
Safety markings are used frequently throughout this
manualtodesignateadegreeorlevelof seriousness and
should not be ignored.WARNING indicates a potentially
hazardous situation that if not avoided, could result in
personalinjuryordeath.CAUTIONindicatesapotentially
hazardoussituationthatifnotavoided,mayresultinminor
or moderate injury or property damage.
WARNING:
ELECTRICAL SHOCK, FIRE OR EXPLOSION
HAZARD
Failure to follow safety warnings exactly could
result in serious injury or property damage.
Improper servicing could result in dangerous
operation, serious injury, death or property
damage.
• Beforeservicing,disconnectallelectricalpower
to the air handler.
• Whenservicingcontrols,labelallwiresprior
to disconnecting. Reconnect wires correctly.
• Verifyproperoperationafterservicing.
WARNING:
The information listed below must be followed
during the installation, service, and operation
of this unit. Unqualified individuals should
not attempt to interpret these instructions or
install this equipment. If you do not posses
mechanical skills or tools, call your local
dealer for assistance. Failure to follow safety
recommendations could result in possible
damage to the equipment, serious personal
injury or death.
WARNING:
PROPOSITION 65 WARNING: This product
contains chemicals known to the state of
California to cause cancer, birth defects or
other reproductive harm.
• Tominimizeequipmentfailureorpersonalinjury,itis
essentialthatonlyqualifiedindividualsinstall,service,or
maintainthisequipment.Ifyoudonotpossesmechanical
skills or tools, call your local dealer for assistance.
• Follow all precautions in the literature, on tags, and
on labels provided with the equipment. Read and
thoroughly understand the instructions provided with
the equipment prior to performing the installation and
operational checkout of the equipment.
• Usecautionwhenhandlingthisapplianceorremoving
components.Personalinjurycanoccurfromsharpmetal
edgespresentinallsheetmetalconstructedequipment.
• Donotstoreanyofthefollowingon,orincontactwith,
the unit: Rags, brooms, vacuum cleaners, or other
cleaning tools, spray or aerosol cans, soap powders,
bleaches, waxes, cleaning compounds, plastics or
plasticcontainers,paperbags or other paper products,
gasoline, kerosene, cigarette lighter fluid, dry cleaning
fluids, paint thinners, or other volatile fluids.
• Installationofequipmentmayrequirebrazingoperations.
Installer must comply with safety codes and wear
appropriate safety equipment (safety glasses, work
gloves,fireextinguisher,etc.)whenperforming brazing
operations.
• Unlessotherwisenotedintheseinstructions,onlyfactory
authorized kits or accessories may be used with this
product.
• Theinstallershouldbecomefamiliarwiththeunitswiring
diagrambeforemakinganyelectricalconnectionstothe
unit.See the unit wiring label or Figures 14 - 16 (pages
24 - 26).
• Always reinstall the doors on the air handler after
servicingorcleaning/changingthefilters.Donotoperate
the air handler without all doors and covers in place.
GENERAL INFORMATION
Requirements & Codes
• The installer must comply with all local codes and
regulations which govern the installation of this type
of equipment. Local codes and regulations take
precedence over any recommendations contained in
these instructions. Consult local building codes for
special installation requirements.
• Allelectricalwiringmustbecompletedinaccordance
with local, state and national codes and regulations
and with the National Electric Code (ANSI/NFPA 70)
or in Canada the Canadian Electric Code Part 1 CSA
C.22.1.
• Install this unit only in a location and position as
specifiedonpage4.ThisunitisdesignedonlyforIndoor
installations and should be located with consideration
of minimizing the length of the supply and return ducts.
SeeTables 4 - 8 (pages 16 - 19) and the rating plate for
proper circulating airflow data.
• This air handler may be used for temporary heating
of buildings or structures under construction. See the
guidelines listed on page 4.
About the Air Handler
Thisappliancehasbeentestedforcapacityandefficiency
in accordance with AHRI Standards and will provide
many years of safe and dependable comfort, providing
it is properly installed and maintained. Abuse, improper
use, and/or improper maintenance can shorten the life of
the appliance and create unsafe hazards.Please read all
instructions before installing the unit.
4
BeforeYou Install this Equipment
√This equipment is securely packaged at the time of
shipmentanduponarrivalshouldbecarefullyinspected
for damage prior to installing the equipment at the job
site.Claimsfordamage(apparentorconcealed)should
be filed immediately with the carrier.
√it is recommended that the cooling load of the area to
be conditioned should be calculated and a system of
the proper capacity selected.
√Checktheelectrical supplyandverifythe powersupply
isadequateforunitoperation.Thesystemmustbewired
and provided with circuit protection in accordance with
localbuildingcodes.Ifthereisanyquestionconcerning
the power supply, contact the local power company.
√Verify the duct system is appropriate for the air handler
being installed. Please note that when replacing an
existing system with lower air-flow, the duct system
may require modification.
Minimum Clearances
• This appliance must be installed in accordance with
clearances listed in Table 1. The air handler must be
installed with ample clearance for easy access to the
air filter, blower assembly, heater assembly, controls,
and vent connections.
• Staticpressure dropthrough louveredopenings and
through return air plenums should be considered in
the overall duct design in the determination of the total
external static pressure.
Table 1. Minimum Unit Clearances
INSTALLATION CLEARANCES
Left Side......... 0 Inches Right Side...... 0 Inches
Back...............0 Inches Front........... †See Notes
†
NOTE:
Closet or Alcove Installations:
• Allow24in.minimumclearancefromfrontofunitto
nearestwallorpartition forservicing.Recommended
clearance is 36 in.
REAR
RIGHT
SIDE
LEFT
SIDE
FRONT
Locating the Air Handler
• Surveythejobsitetodeterminethebestlocationfor
mounting the unit. Consideration should be given to
availabilityofelectricpower,serviceaccess,andnoise.
• Thedimensions of theroom oralcovemustbe able
to accommodate the overall size of the unit and the
installation clearances listed in Table 1. Physical
dimensions for this air handler are shown in Figure 7
(page 14).
• Theairhandlershouldbesetintopositionbeforerouting
the refrigerant tubing.
Operation of an Air Handler During Construction
CAUTION:
Failuretofollowtheseinstructionswillvoidthe
factory warranty and may significantly reduce
the life or the performance of the air handler,
and/or result in other unsafe conditions. It is
the responsibility of the installing contractor
to insure these provisions are met.
Operating an air handler in a construction environment
can cause the appliance a variety of problems. Proper
use of commercial portable space heating equipment
during construction is recommended. This air handler
may be used during construction if it is not in violation of
any applicable codes and the following criteria are met:
• The installation must meet all applicable codes and
be permanently installed according to the instructions
supplied with the air handler including electrical supply
and duct work.
• Theairhandlermustbecontrolledbyaproperlyinstalled
thermostat that complies with the current provisions
of the NEC (ANSI/NFPA 70) and all applicable codes
having jurisdiction. Thermostat connections must be
made in accordance with instructions supplied with the
air handler and thermostat. See page 9.
• Theinstallationmustincludeaproperlyinstalledlterin
thereturn air systemwithnoby-passair.The filter must
be inspected frequently and replaced when necessary.
• Returnairmustbesuppliedunrestrictedandlocated
such that dust and gases from construction activity are
not introduced into the circulating air system.
• Before occupying the structure: The lter must be
replaced or cleaned, the duct work must be inspected
and cleaned of any construction debris, and the air
handler must be cleaned and/or repaired if found to
be dirty, damaged, or malfunctioning in any way by
a qualified HVAC technician. The air handler shall be
inspected and approved by applicable local authority
even if this requires redundant inspections.
• The serial number for the air handler used during
construction must be submitted in writing (fax and
email also acceptable).This information will be used to
track the long-term affects of air handler usage during
construction.Proofofthissubmittalshallbeavailablefor
thefinalinspectionoftheairhandlerpriortooccupancy.
5
• It is good practice to seal all connections and joints
with industrial grade sealing tape or liquid sealant.
Requirements for sealing ducts vary from region to
region.Consultwithlocalcodesforrequirementsspecific
to your area.
Supply Air Connections
The supply air must be delivered to the heated space by
duct(s) secured to the blower’s casing, running full size
andwithoutinterruption.Tapeorsealallseamsifrequired
by local code.
Upflow& HorizontalApplications:Toattachthesupply air
duct, bend the flanges (on top of the unit) outward 90°
with a pair of wide duct pliers.Position the duct on top of
the blower and secure together with sheet metal screws.
Downflow Applications: Position the blower over the duct
and secure together with sheet metal screws.
Return Air Connections
The return air must be delivered to the blower by duct(s)
secured to the casing, running full size and without
interruption.Tapeorsealallseamsifrequiredbylocalcode.
Upflow&HorizontalApplications:Positiontheblowerover
the duct and secure together with sheet metal screws.
Downflow Applications: To attach the supply air duct,
bend the furnace flanges outward 90° with a pair of wide
duct pliers.Position the duct on top of the cased coil and
secure together with sheet metal screws.
Acoustical Duct Work
• Certain installations may require the use of acoustical
lininginsidethesupplyductwork.Acoustical insulation
must be in accordance with the current revision of the
Sheet Metal and Air Conditioning Contractors National
Association (SMACNA) application standard for duct
liners.DuctliningmustbeULclassifiedbattsorblankets
with a fire hazard classification of FHC-25/50 or less.
• Fiberductworkmaybeusedinplaceofinternalduct
liners if the fiber duct work is in accordance with the
current revision of the SMACNA construction standard
on fibrous glass ducts. Fibrous duct work and internal
acoustical lining must be NFPA Class 1 air ducts when
tested per UL Standard 181 for Class 1 ducts.
• Damping ducts, flexible vibration isolators, or pleated
media-style filters on the return air inlet of the air
handler may be used to reduce the transmission of
equipment noise eminating from the air handler.These
treatmentscanproduceaquieterinstallation,particularly
in the heated space. However, they can increase the
pressure drop in the duct system. Care must be taken
to maintain the proper maximum pressure rise across
the air handler, temperature rise and flow rate. This
maymeanincreasingtheductsizeand/or reducing the
blower speed. These treatments must be constructed
and installed in accordance with NFPA and SMACNA
construction standards. Consult with local codes for
special requirements.For best sound performance, be
sure to install all the needed gaskets and grommets
Plenums & Air Ducts
• Plenums and air ducts should be installed in
accordance with the standards of the National Fire
Protection Association Standard for Installation of
Air Conditioning Systems (NFPA 90A), Standard for
Installation of Residence Type Warm Air Heating
and Air Conditioning Systems (NFPA 90B), and all
applicablelocalcodes.NFPApublicationsareavailable
by writing to: National Fire Protection Association,
Batterymarch Park, Quincy, ME 02269 or visit
www.NFPA.org online.
WARNING:
All return ducts must be secured to the air
handler using appropriate methods. All return
ducts must be adequately sealed.When return
air is provided through the bottom of the unit,
the joint between the air handler and the return
air plenum must be air tight.
Returnairandcirculatingairductsmustnotbe
connected to any other heat producing device
such as a fireplace insert, stove, etc.This may
result in fire, explosion, carbon monoxide
poisoning,personalinjury,orpropertydamage.
• Designtheductworkaccordingtomethodsdescribed
bytheAirConditioningContractorsofAmerica(ACCA).
• Thisunitisdesignedonlyforusewithareturnandsupply
duct.The return air duct must have the same free area
as the opening provided on the air handler.The ducts
should be appropriately sized to the capacity of the air
handler to ensure its proper airflow rating.
• This unit should be located with consideration of
minimizing the length of the supply and return ducts.
See Tables 4 - 8 (pages 16 - 19) and the rating plate
for proper circulating airflow data.
• Wheneverthesupplyorreturnairductspassthrough
the floor, a 1/4” thick noncombustible resilient gasket
must be used between the duct, unit and floor
• Use transition ttings if the supply and/or return air
openings of the unit do not match the duct openings.
Thesetransitionsshouldbedimensionedinaccordance
with standard practice as specified in the ASHRAE
recommendations for duct transitions.
• The supply air ductwork must be of noncombustible
material for the first 24 inches from the unit. Some
installations with a short, straight run from the unit to
the first branch takeoff may require acoustical lining
insidethesupplyair ductwork.Consult withlocalcodes
for requirements specific to your area.
• Flexible connectors may be used between the unit
and the ductwork to prevent transmission of vibration
from the unit to the structure. If electric heater kits are
installed, heat resistant material must be used for the
flexible connector at the supply air end of the unit.
6
around penetrations into the air handler, such as for
electrical wiring.
Air Filters
WARNING:
Never operate the air handler without a filter
or with doors removed. Dust and lint can build
upon internal components,resulting in loss of
efficiency,equipmentdamage,andpossiblefire.
MB7 Series air handlers are not equipped with filter
racking; however, NORDYNE strongly recommends that
a filter be located in the return air duct system.Installing
the filter and replacing it every 3 months will increase air
quality throughout the home.
Unconditioned Spaces
All duct work passing through unconditioned space must
beproperlyinsulatedtominimizeductlossesandprevent
condensation.Use insulation with an outer vapor barrier.
Consult your Distributor for the recommended type and
thickness of insulation for your area as required by local
codes.
Condensate Drainage
CAUTION:
The air handler must be level to ensure proper
condensate drainage. An unlevel installation
may result in structural damage, premature
equipment failure, or possible personal injury.
• Modular air handlers are intended to be mated with
specific NORDYNE C6 cased coils. To ensure proper
condensate drainage, the unit must be installed in a
levelposition within 1/4 inch over theheight,width,and
depth of the unit.The best system performance will be
obtained if the unit is located in a centralized position
with respect to the air distribution system.Refer to the
Installation Instructions supplied with the Cased Coil
for proper condensate drain connections.
• Iftheairhandlerislocatedinorabovealivingspace
where damage may result from condensate overflow,
anauxiliarydrainpanshouldbeinstalledundertheunit.
A separate drain line should extend from the pan to a
conspicuous point and serve as an alarm indicating
that the primary drain is restricted.As an alternative to
a separate drain line, an approved water level indicator
or float switch device should be used to shut down the
unit in the event water is detected in the auxiliary pan.
• During system checkout, inspect the drain line and
connections to verify proper condensate drainage.
• Methodsfordisposingofcondensatevaryaccording
to local codes.Refer to local codes or authority having
jurisidiction for restrictions and proper condensate
disposal requirements.
AIR HANDLER INSTALLATION
The MB7 Series air handler is shipped ready for vertical
upflow installation and is approved for attic, basement,
alcove/closetorcrawlspaceinstallationwithzeroclearance
to combustibles. They may also be applied in downflow
or horizontal left and right discharge applications. See
Table1(page4) forrequired installationclearances.This
appliance is approved only for indoor use.
NOTE: For shipping purposes, the front and rear joining
brackets are located in the unit’s heater box. Remove
these two items from the heater box before beginning.
• Theunitmustbeleveledatinstallationandattachedto
a properly installed duct system.
• Thesurfacethattheairhandlerismountedonmust
provide sound physical support of the unit.
• Theairhandlermustbeinstalledsothatallelectrical
components are protected from water.
• Ifalouvereddoorisinstalledacrossthefrontofthis
unit, the appliance must be mounted flush or behind
front edge of finished wall.
• Modular air handlers are intended to be mated with
specific NORDYNE C6 cased coils. Reference the
Technical Specifications for coil mating combinations.
Upflow Installation
The MB7 Series air handler is shipped from the factory
readyforupflowconfigurationasshowninFigure1(page
7).Returnairmustmustenterfromthebottomof the unit.
1. Remove the bracket above the door of the cased coil.
Retain the screws for later use. NOTE: Before mating
the modular unit with the cased coil, clean the mating
surfaces on both units and apply the black neoprene
gasket tape to the top of the coil case (except the rear
surface).Make sure there are no gaps on the front and
side flanges.
2.Carefully place the modular air handler on top of the
cased coil making sure not to damage the cased coil
flanges.Theunitswill beflushinfront withanoverhang
in the back as shown in Figure 2 (page 7).
3.Removethelowerfrontbracket(Figure3,page7) from
the modular unit. Retain the screws for later use.
4.Attachthefrontjoiningbrackettothefrontofthemodular
unit.Align the screw holes in the bracket with the holes
from the lower front bracket and the top panel of the
coil case.See Figure 3.
5.Secure the bracket with the screws removed earlier in
steps 1 & 2.
6.Attach the rear joining bracket to the backside of the
modularunitandcasedcoil.Positionthebracketsothat
it is flush with the sides and back of the units with the
1/2” insulation facing the rear gap between the units.
7.Secure the rear bracket with self tapping screws.
7
Figure 1. Upflow & Downflow Installation
Upflow
Configuration Downflow
Configuration
Figure 3. Front Bracket Installation - (Upflow Only)
Front Bracket
Figure 2. Rear Bracket Installation - (Upflow Only)
Rear Bracket
Modular Air Handler
Cased Coil
Upflow
Configuration
Downflow Installation
The MB7 Series Modular air handler may be installed in
a downflow configuration as shown in Figure 1. Return
air must enter through the top of the unit.
1.Remove the lower front bracket (Figure 3) from the
modular unit. Retain the screws for later use.
2.Remove the door from the cased coil and the screws
(onthesideof thecasedcoil)securingthelowertiebar
in place.Retain the screws for later use.NOTE:Before
mating the modular unit with the cased coil, clean the
mating surfaces on both units.
3.Flip the modular unit upside down and apply the black
neoprene gasket tape to the top of the air handler.
NOTE:Theblowersflangedsurfaceisnowbeneaththe
air handler and will connect with the supply air duct.
4.Carefully place the cased coil on top of the modular
air handler.NOTE: Make sure the units are flush in the
front and on the sides with a “step” fit in the back and
that there are no gaps on the sides.See Figure 4.
5.Attach the front joining bracket to the cased coil and
theairhandler.Alignthescrewholesinthebracketwith
the holes where the lower front bracket and lower tie
bar were attached.
6.Secure the bracket to the modular unit and the cased
coil with the screws removed earlier in steps 1 & 2.
7.Attach the rear joining bracket to the backside of the
modular unit.Position the bracket so that it is flush with
the sides and back of the units with the 1/2” insulation
facing the rear gap between the units.
8.Secure the rear bracket to the modular unit and cased
coil with self-tapping screws.
Figure 4. Downflow Brackets
Rear
Bracket
Front
Bracket
Cased
Coil
Modular
Air Handler
8
4.Place the horizontal drain pan on the opposite side of
the coil.On units with 2 sets of knockouts, remove the
other set of knockouts in the coil spacing plates and
insert support rod.
5.Slide the coil and the horizontal drain pan assembly
back into the unit.Re-attach the tube close off plate.
NOTE: For A-size cabinet applications, it may be
preferrable to remove the blower assembly prior
to installing the coil & drainpan. In this case follow
instructions 1-4 as listed above but also remove the
blower access door and blower assembly.The blower
assembly is secured with two screws on either side
nearthefront.Withtheseremovedtheblowerassembly
can slide out of the front of the unit.Install the coil and
drain pan as described in step 5 and then replace the
blower assembly.Take care to ensure that the flanges
on the sides of the blower assembly are captured by
the pockets in the blower deck. It may be necessary
to lift the blower assembly during insertion to allow the
lower blower leg to clear the side of the drain pan.The
blower will stop against the back of the blower deck.
Replace the two screws and the blower access door
and procede with steps 6-9.
6.Remove the plug from one of the threaded holes
in the horizontal drain pan. Completely remove the
webbing located in the threaded holes of the drain
pan. IMPORTANT: If the webbing is not removed, the
condensate will not drain properly and ceiling damage
may occur.
7.Inserttheplug(fromhorizontaldrainpan)intotheopen
and unused drain hole in the drain pan at the bottom
of the unit to block bypass air.
8.Remove the corresponding drain line knockout from
the coil access door to allow access to the horizontal
drain.
9.Replace the door and attach the drain line.
Horizontal Installation
MB7 air handlers are shipped from the factory ready
for horizontal left applications and horizontal right
applications. The blowers can be installed horizontally
in an attic, basement, crawl space or alcove. They can
also be suspended from a ceiling in a basement or utility
room in either a right to left airflow or left to right airflow.
A typical installation of the unit in a suspended horizontal
application is shown in Figure 5.
When mating the blower and coil for horizontal left or
right applications, reference the upflow instructions on
page 6. Make sure to account for the coil orientation by
configuring the coil drain pan assembly properly. Multi-
position procedures are also available in the cased coil
Installation Instructions supplied with the unit.
NOTES:
• In many applications when joined with a C6 cased
coil, the shorter horizontal drain pan extension which
is included with the MB7 must be used.This is to avoid
any interference with the extension included with the
C6 and the blower.
• Theair handler may or may not be shipped from the
factory with all the parts required for horizontal left
applications and horizontal right applications. If your
unit does not have parts for a horizontal application, a
kit may be available.
If suspending the air handler from the ceiling, assemble
asupportframe(Figure5) using slotted iron channel and
full threaded rod. Fasten the frame together with nuts,
washers, and lockwashers. Secure the support frame
to the rafters with lag bolts.The air handler can also be
suspended using steel straps around each end of the
unit.The strapsshouldbeattached totheairhandler with
sheet metal screws and to the rafters with bolts.
Horizontal Left Installations
1.Remove the coil access door.
2.Remove the plug from one of the threaded holes in the
horizontal drain pan. Completely remove the webbing
in the threaded holes of the horizontal drain pan.If the
webbing is not removed, the condensate will not
drain properly and ceiling damage may occur.
3.Inserttheplug(fromhorizontaldrainpan)intotheopen
and unused drain hole in the drain pan at the bottom
of the unit to block bypass air.
4.Remove the corresponding drain line knockout from
the coil access door to allow access to the horizontal
drain.
5.Replace the door and attach the drain line.
Horizontal Right Installations
1.Removethecoilaccessdoor.Unscrewtheline-settube
close-off plate from the front left cabinet rail.
2.Slide the coil and drain pan assembly out of the unit.
3.Remove the sheet metal hairpin covers (if supplied)
from the back of the coil and discard. Figure 5. Unit Horizontally Suspended
Threaded
Rod
Lag
Bolt
Nuts (x2)
Washer
and
Lockwasher
Nuts (x2)
9
ELECTRICAL CONNECTIONS
WARNING:
ELECTRICAL SHOCK, FIRE OR EXPLOSION
HAZARD
Failure to follow safety warnings exactly could
result in serious injury or property damage.
Improper servicing could result in dangerous
operation, serious injury, death or property
damage.
•Beforeservicing,disconnectallelectricalpower
to the air handler.
•When servicing controls, label all wires prior
to disconnecting. Reconnect wires correctly.
• Verifyproperoperationafterservicing.
• Electrical connections must be in compliance with
all applicable local codes and ordinances, and with
the current revision of the National Electric Code
(ANSI/NFPA 70).
• ForCanadianinstallations,theelectricalconnections
and grounding shall comply with the current Canadian
Electrical Code (CSA C22.1 and/or local codes).
Pre-Electrical Checklist
√Verify the voltage, frequency, and phase of the supply
sourcematchthespecificationsonthe unit ratingplate.
√Verify thattheservice providedby theutilityissufficient
tohandletheadditionalloadimposedbythisequipment.
See the unit wiring label orTable 9 (page 20) for proper
high and low voltage wiring.
√Verifyfactorywiringisinaccordancewiththeunitwiring
diagram(Figures14-16,pages24-26).Verifynoneof
theconnectionsloosenedduringshippingorinstallation.
LineVoltage
• Anelectricaldisconnectmustbelocatedwithinsight
ofandreadilyaccessibletotheunit.Thisswitchshall
becapableofelectricallyde-energizingtheoutdoorunit.
Seeunitdatalabel forproperincomingfield wiring.Any
other wiring methods must be acceptable to authority
having jurisdiction.
• Itisrecommendedthatthelinevoltagetotheunitbe
supplied from a dedicated branch circuit containing the
correct fuse or circuit breaker for the unit.
• Overcurrentprotectionmustbeprovidedatthebranch
circuitdistributionpanel and sizedasshownontheunit
ratinglabelandaccordingtoapplicablelocalcodes.See
theunitratingplateandTable9 (page 20) formaximum
circuit ampacity and maximum overcurrent protection
limits.
• The installer should become familiar with the wiring
diagram/schematic before making any electrical
connections to the unit. See the unit wiring label or
Figures 14 - 16.
• Useonlycopperwireforthelinevoltagepowersupply
to this unit.Use proper code agency listed conduit and
a conduit connector for connecting the supply wires to
the unit.Aluminum supply wire may be used if a heater
kit is installed.
• Ifreplacinganyoftheoriginalwiressuppliedwiththe
unit,thereplacementwiremustbecopperwireconsisting
of the same gauge and temperature rating.
• Providepowersupplyfortheunitinaccordancewiththe
unit wiring diagram, and the unit rating plate. Use UL
listedconduitandconduitconnectorsforconnectingthe
supply wires to the unit and for proper grounding.Field
supplied bushings for the power supply cables must be
added to support and protect the power supply cables.
• All208/230Voltunitsareshippedfromthefactorywired
for 240 volt operation.For 208V operation, remove the
lead from the transformer terminal marked 240V and
connect it to the terminal marked 208V.
Thermostat Connections
• Thermostatconnections shallbe in accordancewith
the instructions supplied with the thermostat. The
thermostat used with this equipment must operate in
conjunction with any installed accessories.Typical AC
and air handler hookups are shown in Figure 9 (page
21).
CAUTION:
Isolation must be maintained from the external
Class 2 output of any transformer in a cooling
circuit.Useathermostatwithisolatingcontacts
to prevent inter-connection of Class 2 outputs.
• Wherelocalcodesrequirethatthethermostatwiring
must be routed through a conduit or raceway, splices
can be made inside the unit; however, all wiring must
be NEC Class 1 and must be separated from incoming
power leads.
• Thethermostatshouldbemountedabout5feetabove
theflooronaninsidewall.DONOTinstallthethermostat
on an outside wall or any other location where its
operationmaybeadverselyaffectedbyradiantheatfrom
fireplaces, sunlight, or lighting fixtures, and convective
heat from warm air registers or electrical appliances.
Refertothethermostatmanufacturer’sinstructionsheet
for detailed mounting and installation information.
• Installthegrommet,whichispackedwiththeunit,in
the hole for low-voltage wires. Properly connect the
low-voltage wiring between the thermostat, outdoor
unit, and control board. NOTE: When the low voltage
wires are positioned in this grommet, the grommet will
preventchafingand/orshortingofthelowvoltageleads
10
Important! On variable speed models when the unit is
usedinanairconditioningsystem,connecttheOterminal
to the Yterminal. See Figure 9 (page 20).
Control Board
The control board in the air handler controls the timing
sequence of the elements.Depending on the thermostat
connection,therearemultipletimingsequencevariations
that can be chosen.The board also is equipped with a 3
secondbloweron delayand a15secondbloweroffdelay.
SeeFigures10-13(pages22&23)forcontrolboardlayout
andTables10&11(pages27-29)forelementsequences.
Twinning
MB7 air handlers are not supplied with a built in twinning
capability.Toconnecttwoairhandlerstoacommonsingle
stage AC condensing unit or heat pump, a twinning kit
is available for field installation. IMPORTANT: Variable
speed air handlers cannot be twinned. Please follow
the instructions supplied with the kit.
Heater Kits
Field-installedelectricheaterkitsareavailable.Instructions
for installing the electric heaters are included with the
heaters.Additional heater kit information can be found in
the units Technical Specifications.
Airhandlerssetupwith15kwormoreofelectric heat will
normally be configured for multiple-circuit power supply.
Theymay,however,beconnectedtoasingle-circuitpower
supply with the addition of a single circuit accessory
kit. Select the wire size and over-current protection
in accordance with the minimum circuit ampacity and
maximum over-current protection shown in Table 9.See
also the units Technical Specifications.
When electric heat packages with circuit breakers are
field-installed, the circuit breaker may be used as a
disconnectingmeansinmostapplications.Referencethe
NEC and local codes for disconnect requirements.
If a heater kit is installed:
The MB7 air handler is shipped from the factory without
an electric heater kit installed. If Electric heat is desired,
the H6HK heater kit may be purchased separately and
fieldinstalled.Determinethecorrectsizeheaterkitforyour
unit by referring to the list below or the units rating label.
A Size Cabinet...............................................15Kw max
B Size Cabinet...............................................20Kw max
C Size Cabinet...............................................20Kw max
1.Connect the 2 wire plug of the air handler to the mating
2 wire plug of the heater kit.
2.Connect the line voltage leads to the circuit breaker or
terminal block provided.
3.Connect the heater kit plug with the mating receptacle
on the air handler control board.
If a heater kit is not installed:
1.Removethe2wireplugof the air handlerbycutting the
wires and discarding the plug.
2.Strip the ends of the 2 air handler wires and connect
to the line-voltage leads with the 2 wire nuts provided.
Electronic Air Cleaner (EAC)
The unit has an output to power an electronic air cleaner
when the blower is running. This output is rated to 1.0
amp at 208/240V.
Humidifier
The unit has an output to power a humidifier when the
blower is running. This output is rated to 1.0 amp at
208/240V.
Optional Humidistat
(MB7EM or MB7VM Models Only)
The optional humidistat may be installed in the return air
duct to provide excellent humidity control when needed
andmaximumsystemcapacityandenergyefficiencywhen
humidity levels are normal.The humidistat senses when
humidity in the return air stream is above a preset level
(fieldadjustable)andsendsasignaltothemotortoreduce
theairflowsothatmoremoisturemayberemoveduntilthe
humidity level drops.The air handler is pre-programmed
for humidistat operation.
Install the humidistat in the return air duct as directed in
the installation instructions included with the kit.Wire the
humidistat through the low-voltage wire entrance in the
airhandlerto thecontrolboardterminalmarkedDEHUM.
Wire the humidistat to open on rise in humidity.
Grounding
WARNING:
Theunitcabinetmust haveanuninterruptedor
unbrokenelectricalgroundtominimizepersonal
injury if an electrical fault should occur.Do not
use gas piping as an electrical ground!
This unit must be electrically grounded in accordance
with local codes or, in the absence of local codes, with
the National Electrical Code (ANSI/NFPA 70) or the CSA
C22.1 Electrical Code.Use the grounding lug provided in
the control box for grounding the unit.
11
Blower Configurations
Selecting Minimum Electric Heat Airflow
The minimum electric heat airflow setting controls the
minimum air flow that will be produced whenever electric
heater kits are used. When the electric heater kit is
energizedalongwithaheatpump,theairflowmaybehigher
dependingonthebasiccooling/heat-pumpairflowsetting.
The minimum electric heat airflow is selected by the red
blower wire on 3-speed models or setting switches 1,2,3
&4onB7EMmodels.B7VMmodelsautomaticallysetthe
heatingspeedbasedontheamountofinstalledheat.The
A/B switch must be set appropriately for the unit cabinet
size. For C-sized cabinets, the A/B switch can be set in
either position.The remaining 3 HEAT switches have no
function.Switch settings are listed inTables6or9(pages
20&22).NOTE: ForB7EMModels,theminimumelectric
heat airflow setting may be set higher, but must never be
set lower than the setting shown in Table 6 (page 18).
Determining Nominal System Capacity
To select the appropriate airflows for the air handler, the
nominal system capacity must be known. The nominal
system capacity is always the nominal capacity of the
outdoor unit. However, in some situations the nominal
system capacity may not be the same as the nominal
capacity of the air handler. Always refer to the nominal
capacity of the outdoor unit to determine the nominal
system capacity.
NOTE: The CFM values listed in Table 8 (page 19) are
not dependent on duct static pressure.The VSHE motor
automatically compensates for changes in duct static
pressure (within the limits of the motor).
3-Speed Units
The blower speed is preset at the factory for operation
at the same speed for heating and cooling, by using the
jumping terminal on the blower motor and connecting it
to the desired speed with both the red and black wires
connected to the jumping terminal. NOTE: The control
board is programmed with a 40 second off delay in the
cooling mode for optimum system performance and
efficiency.
CAUTION:
To avoid personal injury or property damage,
make sure the motor leads do not come into
contactwithanyuninsulatedmetalcomponents
of the unit.
For optimum system performance and comfort, it may be
necessary to change the factory set speed. See Table 4
(page 16) for airflow data.To change the blower speed:
1.Disconnect all electrical power to the unit and remove
the upper door.
2.Remove the black and red wires from the blower motor
jumping terminal. Discard the blower motor jumping
terminal.
STARTUP & ADJUSTMENTS
BeforeYou Start the Air Handler
Prior to start-up, complete the following inspections:
√Verifytheunitislevelandproperlylocatedwithadequate
clearances for servicing the unit.SeeTable 1 (page 4).
√Check condensate drain line(s) for proper drainage.
√Verify the surrounding area and top of the unit is free
from obstructions and debris.
√Check all duct connections. Make sure the duct work
is adequately sealed to prevent air leakage.
√Check all coil connections for leaks.
√Verify that the line voltage power leads are securely
connectedandtheunitisproperlygrounded.Makesure
alldoorsareinstalled beforerestoringpowertothe unit
√Verify the thermostat is wired correctly. Make sure all
low voltage wires are securely connected.
√Verify the power supply branch circuit overcurrent
protection is sized properly.
√Verify filter is properly and securely installed.
Air Circulation Check
Running the Blower Continuously
Set the thermostat’s system mode to OFF and the
thermostat’s fan mode to ON. The blower motor should
run continuously.Check for air delivery at the register(s).
Make sure that there are no obstructions at the registers
or in the ducts.
System Cooling
1.Set the thermostat’s system mode to COOL and fan
mode to AUTO. Lower the thermostat’s temperature
mode below room temperature and observe that the
blower energizes. Check the air being discharged at
the register is cooler than room temperature. Verify
unit refrigerant pressures are in order. Blower should
be turning in direction indicated by arrow.
NOTE:DONOTalterunitwiring.Listenforanyunusual
noises.Locate the source and correct as needed.
2.Allow the unit to run for several minutes and then set
thethermostat’stemperatureaboveroomtemperature.
Verify the blower cycles off with the thermostat.
System Heating
1.Set the thermostat’ssystemmodetoHEAT and thefan
mode to AUTO.Increase the thermostat’s temperature
above room temperature and observe that the blower
energizes.Checktheairbeingdischargedattheregister
is warmer than room temperature.
2.Allow the unit to run for several minutes and then set
thethermostat’stemperaturebelowroomtemperature.
Verify the blower cycles off with the thermostat.
Turning the Blower Off
Set thermostat’s fan mode to AUTO, the blower will shut
down immediately.
12
3.Connect the heating speed wire (red) and the cooling
speedwire(black) to the desired blower speed marked
on the terminal block of the blower motor.
• Terminal4=Hispeed
• Terminal5=Medspeed
• Terminal6=Lowspeed
4.Replace the upper door and secure it to the unit.
5.Restore power to the unit.
High Efficiency Units (Variable & Fixed Speed)
IMPORTANT! This air handler has been designed to
give the installer maximum flexibility to optimize system
performance,efficiency,andcomfort.Becausethereareso
manydifferentwaystosetuptheairhandleritisimportant
to read and follow these directions carefully.
B7EM&B7VMairhandlersusehighefficiencycirculating
air motors that come in two variations and both are
controlleddifferently.Thefixedspeedmotorcontrolboard
(Figure 12, page 23) controls the torque and the variable
speedmotorcontrolboard(Figure13)controlstheairflowat
aconstantCFM.Bothboardsusethesamecontrolboard.
Before operation, the air handler must be configured to
matchtheunitwiththesystem,systemoptions,andclimatic
conditions. When configured, the air handler responds
directly to the thermostat inputs, as well as the optional
humidistat (see page 12). During normal operation, the
motor will gradually change speeds during start-up, shut
down,whenthermostatinputschange,andwhentheduct
static pressure changes (vents closed or opened, filter
clogging, etc.). The air handler is configured by setting
the selector switches and removing jumper connectors.
Selecting Basic Heating Airflow
Fixed & variable speed motor control boards (Figures 12
& 13) contain a set of dip switches for setting the blower
speed. For MB7EM models, pins 1-4 set the speed for
heating.ForMB7VMmodels,theA/Bswitchmustbesetfor
theappropriatecabinetsize(eithersettingcanbeusedfor
C-sizecabinets).Theairflowissetautomaticallybasedon
the amount of installed heat.For bothMB7EM & MB7VM
models,thecoolingspeedisselectedviaswitches5,6,7,&
8. To determine the appropriate switch settings for your
installation, see Tables 5 - 8 (pages 17-19).
Selecting Basic Cooling / Heat Pump Airflow
Thebasiccooling/heat-pumpairflowiscontrolledbysetting
switches5-8onthemotorcontrolboard(mountedonthe
blower).All airflows for other modes of operation (except
electric heat) are determined by this basic setting. FAN
ONLY would deliver 50% of the selected cooling airflow.
Table 5 lists the basic airflow values versus the airflow
selector switch settings and ranges of basic air flow
settingsrecommendedforeachnominalsystemcapacity.
• When operating in the heat pump mode, a higher basic
airflow setting will increase the energy efficiency and
capacitybutwillalsodecreasethesupplyairtemperature.
• Formaximumcapacityandenergyefficiency, select an
airflow at or near the top of the range for that nominal
capacity. See Table 7 (page 18).
• Formaximumdehumidification,selectanairflownearthe
middle or bottom of the range for that nominal capacity.
Additionalinformationonhumiditycontrolcan befound
in the Humidistat and Delay Setting sections.
• For thermostats with a dehumidifier output, use a field
supplied wire to connect the thermostat’s dehumidifier
output to the terminal marked DHUM.The thermostat
should be set so that the DHUM output should be high
(energized)whendehumidificationisneeded.Seealso
Dehumidification Options section.
IMPORTANT! If coil icing is observed, the basic cooling/
heat-pump airflow selected may be too low. Verify the
setting selected is within the range shown inTable 7 and
thatthethesystemisproperlycharged.Pleaserefertothe
instructionssuppliedwiththeoutdoorunit.Ificingcontinues
to occur, raise the selected airflow one or two steps.
NOTE: Variable speed air handlers with SEER ratings
higherthan15arematchedwitha2-stagecoolingoutdoor
unit. They are programmed to operate at 75% of the
selected airflow while the system is in the lo-cool mode
and 100% of the selected airflow while in hi-cool mode.
Dehumidification Options
(B7EM or B7VM Models Only)
Both motor control boards (Figures 12 & 13, page 23)
have a DHUM connection that allows the system to
increase the amount of humidity that is removed from
the circulating air.This is accomplished by reducing the
CFM and allowing the cooling coil to become colder.This
will only occur when there is a call for cooling.There are
many ways that this can be electrically wired.
1.If the room thermostat incorporates a humidity sensor
andDHUMoutput,connecttheDHUMonthethermostat
to the DHUM terminal on the motor control board.
2.If using a separate humidistat, connect the DHUM & R
terminals on the humidistat to the DHUM & Rterminals
on the motor control board of the air handler. In this
option, the DHUM output of the humidistat must be set
to be normally open and closed when there is a call for
humidification. See Figure 6.
3.Ifahumidistatisnotavailable,itisanacceptableoption
to connect the R& DHUM terminals on the motor
control board together with a field supplied wire. This
option causes the blower to run at a reduced CFM for
10minutesafteracallforcooling.NOTE:Ifoutdoorunit
is a heat pump, connect the O terminal to DHUM.
DHUM
RR
DHUM
HUMIDISTAT
MOTOR
CONTROL BOARD
Figure 6. DHUM Wiring Configuration
13
UNIT MAINTENANCE
Propermaintenanceismostimportanttoachievethebest
performancefromanairhandler.Someofthecomponents
and their locations are shown in Figure 8 (page 15). If
any component of the air handler must be replaced, use
onlyfactoryauthorizedreplacementpartsspecifiedinthe
Replacement Parts List provided online.
WARNING:
ELECTRICAL SHOCK, FIRE OR EXPLOSION
HAZARD
Failure to follow safety warnings exactly could
result in serious injury or property damage.
Improper servicing could result in dangerous
operation, serious injury, death or property
damage.
•Beforeservicing,disconnectallelectricalpower
to the air handler.
•When servicing controls, label all wires prior
to disconnecting. Reconnect wires correctly.
• Verifyproperoperationafterservicing.
• Thesemaintenanceinstructionsareprimarilyintended
toassistqualifiedtechniciansexperiencedintheproper
maintenance and operation of this appliance.
• Always reinstall the doors on the air handler after
servicingorcleaning/changingthefilters.Donotoperate
the air handler without all doors and covers in place.
• Toachievethebestperformanceandminimizeequipment
failure, it is recommended that a yearly maintenance
checkupbeperformed.Ataminimum,thischeckshould
include the following items:
Air Filter(s)
WARNING:
Never operate the air handler without a filter in
place. Dust and lint in the return air can build
up on internal components,resulting in loss of
efficiency,equipmentdamage,andpossiblefire.
Inspectandreplacetheairfilteratthebeginningofheating
and cooling season. It is recommended that the filter
be cleaned or replaced monthly. Newly built or recently
renovated homes may require more frequent changing
untiltheconstructiondusthasminimized.Filtersdesigned
to remove smaller particles such as pollen, may require
additional maintenance.
Blower Compartment
Dirt and lint can create excessive loads on the motor
resulting in higher than normal operating temperatures
and shortened service life. It is recommended that the
blower compartment be cleaned of dirt or lint that may
have accumulated in the compartment or on the blower
and motor as part of the annual inspection.
TROUBLESHOOTING
If the air handler fails to operate, check the following:
• Istheelectricturnedon?
• Isthethermostatoperatingproperly?
• Aretheblowercompartmentdoor(s)inplace?
• Istheairhandlerdisconnectclosed?
• Hasthecircuitbreakertrippedorthecontrolboardfuse
burnedopen?
• Areanymanualresetswitchesopen?
• Isthelterdirtyorplugged?
• IstheLEDonbothcontrolboardsconstantlyON?If
not, refer to Tables 2 or 3 to determine fault condition.
Blower Fan Wheel
Inspect the blower wheel blades for accumulations of dirt
andcleanifnecessary.Inspectmountingnutfortightness.
Blower Motor & Assembly
Inspect the blower assembly and motor mounting
bracketsfortightnessand corrosion.Correct deficiencies
if necessary.The blower motor contains sealed bearings
and under normal operating conditions, no maintenance
is necessary for the life of the equipment.
Cooling Coil
Inspect the cooling coil, drain pan, and condensate drain
at the beginning of each cooling season for cleanliness.
Clean these components as necessary using a mild
detergent and water. After cleaning, flush the coil, drain
pan, and condensate drain to remove all detergent.
IMPORTANT: Use caution when cleaning these
components so that the insulation does not get wet.
RED LED (AN2) DIAGNOSTIC
OFF Control Fault (No Power)
Flash Blower Fault
ON Normal Operation
Table 2. Air handler Control Board Fault Conditions
Table 3. Motor Control Board Fault Conditions
DIAGNOSTIC GREEN
LED RED
LED
Fixed
Speed
Furnaces
Control Fault (No Power) Off Off
Normal Operation On On
Motor Fault On Flash
Twin Fault (no motor fault) Flash On
Communications Fault Flash Flash
Variable
Speed
Furnaces
Control Fault (No Power) Off Off
Normal Operation On On
Motor Fault On Flash
Communications Fault Flash Flash
14
FIGURES &TABLES
Figure 7. MB7 Series Physical Dimensions
Cabinet Size Dimension A Dimension B Dimension C
A 12-3/4 24-3/4 14-1/4
B 12-3/4 24-3/4 17-1/2
C 18-1/4 27-1/2 21
"B"
"A"
12 7/8 3/4 TYP.
1 3/4
Ø 1 7/8 K.O.
3 1/4
1 1/4
"C"
22”
1”
1 7/8 3 1/2
5 1/2
2 5/8
Ø1 1/8” K.O.
(TYP.) 1 1/4
2 7/8
TOP
VIEW
Ø 7/8 K.O.
1 7/8
Ø1 1/8” K.O.
Ø1 3/4” K.O.
3/4 TYP.
FRONT
VIEWLEFT SIDE RIGHT SIDE
BOTTOM
VIEW
15
Heating Element
Assembly
Motor
Mount Kit
Blower
Motor
Blower
Wheel
Blower
Housing
Transformer
Control
Board
Coil Assembly
Outlet Heater Box
Lower Front
Bracket
Blower
Door Motor Control
Board
Rear
Bracket
Front Joining
Bracket
Figure 8. MB7 Series Component Locations
16
Table 4. Airflow Data for MB7BM Air Handlers
MB7BM Airflow Data
Dry Coil ESP 0.10 0.20 0.30 0.40 0.50 0.60 0.70 0.80
0800
A-Cabinet
Low 685 645 605 565 515 465 405 345
Corrected ESP10.07 0.19 0.30 0.42 0.53 0.65 0.76
Med 860 825 780 735 680 625 565 500
Corrected ESP10.11 0.23 0.36 0.48 0.60 0.72
High 1070 1025 975 920 860 800 730 660
Corrected ESP10.14 0.27 0.40 0.53 0.67
1200
A-Cabinet
Low 850 825 795 755 705 645 580 510
Corrected ESP10.04 0.15 0.27 0.38 0.50 0.62 0.74
Med 1120 1085 1045 995 940 875 800 715
Corrected ESP10.04 0.17 0.29 0.42 0.55 0.68
High 1275 1235 1185 1130 1070 1005 935 860
Corrected ESP10.10 0.23 0.36 0.49 0.63
1200
B-Cabinet
Low 995 955 910 845 780 705 610 530
Corrected ESP10.08 0.19 0.31 0.42 0.54 0.65 0.76
Med 1335 1290 1235 1175 1100 1015 925 805
Corrected ESP10.10 0.22 0.34 0.46 0.59 0.71
High 1470 1425 1360 1300 1225 1135 1050 920
Corrected ESP10.08 0.22 0.37 0.51 0.65
1600
C-Cabinet
Low 1035 1005 970 925 875 825 770 710
Corrected ESP10.11 0.22 0.33 0.44 0.54 0.65 0.76
Med 1635 1595 1525 1475 1405 1305 1210 1060
Corrected ESP10.08 0.20 0.32 0.44 0.57 0.69
High 1910 1840 1760 1685 1595 1495 1395 1250
Corrected ESP10.14 0.26 0.39 0.52 0.65
2000
C-Cabinet
Low 1520 1510 1500 1485 1465 1440 1415 1385
Corrected ESP10.11 0.21 0.31 0.42 0.52 0.62 0.72
Med 1900 1885 1860 1830 1790 1740 1680 1620
Corrected ESP10.06 0.16 0.27 0.37 0.48 0.59 0.70
High 2245 2195 2135 2080 2015 1950 1885 1800
Corrected ESP10.12 0.23 0.34 0.45 0.56 0.67
1ESP estimate with wet coil and filter
BLOWER PERFORMANCE DATA
17
Table 5. Airflow Data for MB7EM Air Handlers
B7EM
A-cabinet
Switch Settings
0 = OFF, 1 = ON Cooling or Heating Airflow (CFM)
Dry Coil ESP
1/5 2/6 3/7 4/8 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8
0 0 0 0 585 550 520 460 420 405
1 0 0 0 710 670 650 610 560 530 475 440
0 1 0 0 845 790 765 715 680 655 625 580
1 1 0 0 890 865 840 785 760 710 680 655
0 0 1 0 955 925 900 850 825 790 770 720
1 0 1 0 1030 995 975 940 910 870 840 815
0 1 1 0 1115 1085 1060 1020 995 965 925 905
1 1 1 0 1155 1130 1095 1070 1040 1010 985 950
0 0 0 1 1200 1175 1145 1110 1085 1060 1025 1000
1 0 0 1 1240 1215 1195 1170 1140 1110 1080 1060
0 1 0 1 1320 1290 1265 1240 1215 1185 1160 1130
1 1 0 1 1355 1330 1305 1280 1255 1220 1200 1175
0 0 1 1 1405 1375 1345 1325 1295 1275 1250 1210
1 0 1 1 1440 1415 1385 1355 1325 1290 1255 1215
0 1 1 1 1465 1425 1390 1355 1320 1290 1260 1215
1 1 1 1 1465 1425 1390 1355 1320 1290 1260 1215
B7EM
B-cabinet
Switch Settings
0 = OFF, 1 = ON Cooling or Heating Airflow (CFM)
Dry Coil ESP
1/5 2/6 3/7 4/8 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8
0 0 0 0 600 550 430 390
1 0 0 0 660 610 540 460 425
0 1 0 0 830 750 695 640 580 520
1 1 0 0 860 825 765 690 630 600 525 485
0 0 1 0 935 895 835 790 710 655 620 585
1 0 1 0 1045 975 920 875 830 795 720 685
0 1 1 0 1095 1040 995 950 900 850 805 750
1 1 1 0 1155 1105 1060 1010 965 920 870 825
0 0 0 1 1230 1185 1140 1090 1045 1010 965 920
1 0 0 1 1285 1260 1210 1165 1125 1080 1040 1010
0 1 0 1 1330 1290 1245 1205 1170 1125 1085 1045
1 1 0 1 1395 1365 1315 1275 1235 1205 1160 1130
0 0 1 1 1450 1405 1375 1335 1295 1260 1220 1180
1 0 1 1 1490 1450 1410 1385 1340 1300 1270 1230
0 1 1 1 1530 1485 1460 1425 1380 1350 1310 1280
1 1 1 1 1530 1490 1465 1425 1390 1350 1310 1285
B7EM
C-cabinet
Switch Settings
0 = OFF, 1 = ON Cooling or Heating Airflow (CFM)
Dry Coil ESP
1/5 2/6 3/7 4/8 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8
0 0 0 0 710 580 395
1 0 0 0 830 690 675 530 505
0 1 0 0 930 875 710 665 560 530
1 1 0 0 1065 1015 900 840 800 705 665 635
0 0 1 0 1185 1115 1010 960 925 875 830 745
1 0 1 0 1275 1220 1175 1120 1060 970 930 890
0 1 1 0 1365 1350 1255 1200 1150 1105 1060 1025
1 1 1 0 1480 1430 1370 1325 1265 1225 1185 1140
0 0 0 1 1560 1535 1485 1430 1375 1335 1285 1240
1 0 0 1 1650 1600 1545 1500 1450 1405 1360 1305
0 1 0 1 1730 1685 1660 1610 1570 1520 1470 1420
1 1 0 1 1785 1740 1695 1645 1615 1545 1510 1470
0 0 1 1 1865 1820 1785 1750 1695 1655 1605 1560
1 0 1 1 1920 1890 1850 1805 1765 1715 1675 1640
0 1 1 1 2010 1965 1960 1900 1850 1810 1775 1730
1 1 1 1 2065 2020 1985 1955 1915 1880 1840 1810
NOTE: When matched with two-stage outdoor units, the airflow on low (Y1 or W1) input will be 70% of the values shown in this table.
18
A-CABINET
CFM SWITCH SETTINGS
(1 = ON, 0 = OFF) NOMINAL
CAPACITY
5678
525 0 0 0 0
1.5TON
560 0 0 0 1
600 0 0 1 0
625 0 0 1 1
700 0 1 0 0
2TON
750 0 1 0 1
800 0 1 1 0
2.5TON
850 0 1 1 1
875 1 0 0 0
890 1 0 0 1
930 1 0 1 0
950 1 0 1 1
1000 1 1 0 0
3TON
1050 1 1 0 1
1125 1 1 1 0
1200 1 1 1 1
B-CABINET C-CABINET
CFM SWITCH SETTINGS
(1 = ON, 0 = OFF) NOMINAL
CAPACITY CFM SWITCH SETTINGS
(1 = ON, 0 = OFF) NOMICAL
CAPACITY
5678 5678
525 0 0 0 0
1.5TON
1100 0 0 0 0
3TON
560 0 0 0 1 1200 0 0 0 1
3.5TON
600 0 0 1 0 1250 0 0 1 0
650 0 0 1 1
2TON
1300 0 0 1 1
4TON
700 0 1 0 0 1350 0 1 0 0
750 0 1 0 1 1400 0 1 0 1
800 0 1 1 0
2.5TON
1450 0 1 1 0
850 0 1 1 1 1500 0 1 1 1
875 1 0 0 0 1550 1 0 0 0
950 1 0 0 1 1600 1 0 0 1
5TON
1050 1 0 1 0
3TON
1650 1 0 1 0
1150 1 0 1 1
3.5TON
1700 1 0 1 1
1250 1 1 0 0 1750 1 1 0 0
1350 1 1 0 1
4TON
1800 1 1 0 1
1400 1 1 1 0 1900 1 1 1 0
1600 1 1 1 1 2000 1 1 1 1
Cabinet Nominal Electic Heat KW
5 8 10 15 20
A 800 900 1000 1300 N/A
B 900 1000 1100 1300 1500
C 1000 1100 1200 1400 1600
NOTE: See Table 6 for appropriate switch settings for these airflows.
Table 6. Minimum Heating Airflow Settings (in CFM)
for MB7EM (FSHE) Air Handlers
Table 7. Recommended Cooling Airflow Settings for MB7VM Air Handlers
19
B7VM
A-cabinet
Cooling Airflow Heating Airflow
A/B Switch Setting
0=OFF,1=ON
COOL Switch Setting
0=OFF,1=ON Airflow
(CFM) A/B Switch Setting
0=OFF,1=ON
Heater Kit
Installed (KW) Airflow
(CFM)
5678
0 0 0 0 0 525 0 0 600
0 0 0 0 1 560 0 5 800
0 0 0 1 0 600 0 8 1000
0 0 0 1 1 625 0 10 1000
0 0 1 0 0 700 0 15 1300
0 0 1 0 1 750 0 20 N/A
0 0 1 1 0 800 0 25 N/A
0 0 1 1 1 850 0 30 N/A
0 1 0 0 0 875
0 1 0 0 1 890
0 1 0 1 0 930
0 1 0 1 1 950
0 1 1 0 0 1000
0 1 1 0 1 1050
0 1 1 1 0 1125
0 1 1 1 1 1200
B7VM
B-cabinet
Cooling Airflow Heating Airflow
A/B Switch Setting
0=OFF,1=ON
COOL Switch Setting
0=OFF,1=ON Airflow
(CFM) A/B Switch Setting
0=OFF,1=ON
Heater Kit
Installed (KW) Airflow
(CFM)
5678
1 0 0 0 0 525 1 0 700
1 0 0 0 1 560 1 5 900
1 0 0 1 0 600 1 8 1100
1 0 0 1 1 650 1 10 1100
1 0 1 0 0 700 1 15 1300
1 0 1 0 1 750 1 20 1500
1 0 1 1 0 800 1 25 N/A
1 0 1 1 1 850 1 30 N/A
1 1 0 0 0 875
1 1 0 0 1 950
1 1 0 1 0 1050
1 1 0 1 1 1150
1 1 1 0 0 1250
1 1 1 0 1 1350
1 1 1 1 0 1400
1 1 1 1 1 1600
B7VM
C-cabinet
Cooling Airflow Heating Airflow
A/B Switch Setting
(*=either0or1)
COOL Switch Setting
0=OFF,1=ON Airflow
(CFM) A/B Switch Setting
(*=either0or1)
Heater Kit
Installed (KW) Airflow
(CFM)
5678
* 0 0 0 0 1100 * 0 800
* 0 0 0 1 1200 * 5 1000
* 0 0 1 0 1250 * 8 1200
* 0 0 1 1 1300 * 10 1200
* 0 1 0 0 1350 * 15 1400
* 0 1 0 1 1400 * 20 1600
* 0 1 1 0 1450 * 25 N/A
* 0 1 1 1 1500 * 30 N/A
* 1 0 0 0 1550 NOTES:
• Airowvalueslistedarefor240Voperation.For208V
operation, multiply A & B cabinet values by .95; for
C-cabinet values mulitply by .90
• Whenmatchedwithtwo-stageoutdoorunitstheairow
onlow(Y1orW1)input only will be 70% ofthe values
shown in this table.
* 1 0 0 1 1600
* 1 0 1 0 1650
* 1 0 1 1 1700
* 1 1 0 0 1750
* 1 1 0 1 1800
* 1 1 1 0 1900
* 1 1 1 1 2000
Table 8. Airflow Data for MB7VM (VSHE) Air Handlers
20
Table 9. Minimum Circuit Ampacity & Maximum Overcurrent Protection
MB7BM
CABINET CAPACITY
HEAT KI
MODEL
NUMBER
6HK-
240VAC, 50 & 60 HZ, SINGLE PHASE 208VAC, 50 & 60 HZ, SINGLE PHASE
MCA MOP MCA MOP
CIRCUIT
A
CIRCUIT
B
CIRCUIT
C
SINGLE
CIRCUIT
CIRCUIT
A
CIRCUIT
B
CIRCUIT
C
SINGLE
CIRCUIT
CIRCUIT
A
CIRCUIT
B
CIRCUIT
C
SINGLE
CIRCUIT
CIRCUIT
A
CIRCUIT
B
CIRCUIT
C
SINGLE
CIRCUIT
A 800CFM
None 1.6 - - 1.6 15 - - 15 1.6 - - 1.6 15 - - 15
005H-XX 26.6 - - 26.6 30 - - 30 23.3 - - 23.3 25 - - 25
008H-XX 41.2 - - 41.2 45 - - 45 35.9 - - 35.9 40 - - 40
010H-XX 51.6 - - 51.6 60 - - 60 45.0 - - 45.0 45 - - 45
015H-XX 51.6 25 - 76.6 60 30 - 80 45.0 21.7 - 66.6 45 25 - 70
B 1200CFM
None 2.6 - - 2.6 15 - - 15 2.6 - - 2.6 15 - - 15
005H-XX 27.6 - - 27.6 30 - - 30 24.3 - - 24.3 25 - - 25
008H-XX 42.2 - - 42.2 45 - - 45 36.9 - - 36.9 40 - - 40
010H-XX 52.6 - - 52.6 60 - - 60 46.0 - - 46.0 50 - - 50
015H-XX 52.6 25.0 - 64.7 60 30 - 80 46.0 21.7 - 67.6 50 25 - 70
020H-XX 52.6 50.0 - 102.6 60 60 - 110 46.0 43.3 - 89.3 50 45 - 90
C 1600CFM
None 3.1 - - 3.1 15 - - 15 3.1 - - 3.1 15 - - 15
005H-XX 28.1 - - 28.1 30 - - 30 24.8 - - 24.8 25 - - 25
008H-XX 42.7 - - 42.7 45 - - 45 37.4 - - 37.4 40 - - 40
010H-XX 53.1 - - 53.1 60 - - 60 46.5 - - 46.5 50 - - 50
015H-XX 53.1 - 65.6 60 - 80 46.5 21.7 - 68.1 50 25 - 70
020H-XX 53.1 - 103.1 60 - 110 46.5 43.3 - 89.8 50 45 - 90
C 2000CFM
None 5 - - 5 15 - - 15 5 - - 5 15 - - 15
005H-XX 30 - - 30 35 - - 35 26.7 - - 26.7 30 - - 30
008H-XX 44.6 - - 44.6 45 - - 45 39.3 - - 39.3 40 - - 40
010H-XX 55 - - 55 60 - - 60 48.3 - - 48.3 50 - - 50
015H-XX 55 25 - 80 60 30 - 80 48.3 21.7 - 70.0 50 25 - 70
020H-XX 55 50 - 105 60 60 - 110 48.3 43.3 - 91.7 50 45 - 100
MB7(E,V)M
A 1200CFM
None 4.5 - - 4.5 15 - - 15 4.8 - - 4.8 15 - - 15
005H-XX 29.5 - - 29.5 30 - - 30 26.4 - - 26.4 30 - - 30
008H-XX 44.1 - - 44.1 45 - - 45 39.1 - - 39.1 40 - - 40
010H-XX 54.5 - - 54.5 60 - - 60 48.1 - - 48.1 50 - - 50
015H-XX 54.5 25.0 - 68.1 60 30 - 80 48.1 21.7 - 69.8 50 25 - 70
B 1600CFM
None 4.5 - - 4.5 15 - - 15 4.8 - - 4.8 15 - - 15
005H-XX 29.5 - - 29.5 30 - - 30 26.4 - - 26.4 30 - - 30
008H-XX 44.1 - - 44.1 45 - - 45 39.1 - - 39.1 40 - - 40
010H-XX 54.5 - - 54.5 60 - - 60 48.1 - - 48.1 50 - - 50
015H-XX 54.5 - 68.1 60 - 80 48.1 - 69.8 50 - 70
020H-XX 54.5 50.0 - 104.5 60 60 - 110 48.1 43.3 - 91.4 50 45 - 100
C 2000CFM
None 6.3 - - 6.3 15 - - 15 6.8 - - 6.8 15 - - 15
005H-XX 31.3 - - 31.3 35 - - 35 28.4 - - 28.4 30 - - 30
008H-XX 45.8 - - 45.8 50 - - 50 41.1 - - 41.1 45 - - 45
010H-XX 56.3 - - 56.3 60 - - 60 50.1 - - 50.1 60 - - 60
015H-XX 56.3 - 81.3 60 - 90 50.1 - 71.8 60 - 80
020H-XX 56.3 - 106.3 60 - 110 50.1 - 93.4 60 - 100
*All wire sizes for copper conductors only, based on NEC Table 310-16.
**Required for C-cabinet variable speed.
***Circuit ampacity slightly higher for variable speed.See label on blower.
ELECTRICAL DATA & DIAGRAMS
This manual suits for next models
2
Table of contents
Other Nordyne Air Handler manuals
Popular Air Handler manuals by other brands
robatherm
robatherm RM Installation and assembly
Lennox
Lennox BCE3M*C SERIES installation instructions
International comfort products
International comfort products ENH4X installation instructions
Daikin
Daikin FWF02D Installation and operation manual
Salda
Salda VEKA INT EKO Series Technical manual
Mars
Mars Comfort-Aire Century VCD18 SA Series owner's manual
Trane
Trane TWE031E13FB1 Installer's guide
Salda
Salda AMBERAIR COMPACT S-CX H Operation, installation & maintenance instructions
Awenta
Awenta PRO AQUILA 305 Operation and installation manual
Lennox
Lennox LRP14GN Series installation instructions
Salda
Salda RIRS 400VE EKO 3.0 Technical manual
Nortek
Nortek B6BW Series installation instructions
