Sinclair SP-300A User manual

USER'S MANUAL
SP-300A
AIR PURIFIER

Thank you for choosing SINCLAIR air purifier.Please,read this manual carefully before use to make sure you are in the right way, and properly keep it
for future reference.
In order to continuously improve the product quality to meet customers' requirements, the company is entitled
to make appropriate changes on the product specifications. And the users will not be informed.
Please understand.
The applicable area is the impact area when the machine is running at high speed.
Model
PK
:
G%
P
PP
NJ
SP-300A
9+]
Turbo
396 (W)h245 (D) h576 (H)
4QFDJGJDBUJPOT
Fan
Speed
Air Flow
Power
Noise
Dimension
High Low
Mute
Maximum Cleaning
area
Power supply
Net weight

Correct Disposal of this product
This marking indicates that this product should not be
disposed with other household wastes throughout the
EU. To prevent possible harm to the environment or
human health from uncontrolled waste disposal, recycle
it responsibly to promote the sustainable reuse of material
resources. To return your used device, please use the
return and collection systems or contact the retailer
where the product was purchased. They can take this
product for environmental safe recycling.
Product Introduction
Attentions
Contents
Master Operation
Parts function
Remote Control Operation
Disassembly method
Maintenance instructions
1
3
2
7
9
5
4
8
10
12
11
Thoubleshooting 14
Welcome to buy SINCLAIR air purifier, please keep this manual for future
reference in order to properly use the air purifier.
Safety Tips
Partsname
Preparation before use
Cleanning and maintenance

Product Introduction
Remote control
g
g
Accessory
g
g
g
g
gSilver ions anti-bacterial and anti-fungus
Inhibit various types of bacteria. It is washable, and the function is lasting.
g
SINCLAIR air purifier applies HIMOP and other high-technique. Through six
purifi cation functions of anti-bacterial and anti-fungus filter, catalytic decomposi-
tion of the cold catalyst, HIMOP efficient wiping out formaldehyde, HEPA
high efficient filter, activated carbon adsorption technology, it can effecti-
vely remove airborne bacteria, dust, harmful gases etc.
Catalytic decomposition of the cold catalyst
It has strong catalytic ability, can decompose eliminate odors rapidly, and will not cause secondary pollution.
HIMOP can efficiently wipe out formaldehyde
It has unique functions of adsorption and catalytic decomposition. It can
catalyse and decompose hazardous substances, especially absorb them
HEPA high efficient filter
It can 99% efficiently filtrate floating particles of 0.3 micron above (bacteria,
dead mites, dust particles, etc.), and fast refresh the indoor air.
The conductive carbon can efficiently adsorb harmful gases.
The conductive carbon filter products in new type have specific activated carbon that has high
adsorption ability, which can thoroughly remove the harmful gases like ammonia, acetic acid, etc.
Plasma
It releases ionic groups, and efficiently kill the natural bacteria in the air.
Negative ion
Forests and waterfalls surrounding the air is rich in negative ions, known as "air vitamins" refreshing
mode, the release of this product negative ions, so that room air fresh and natural.
Sleep mode
Cotton filter(3)
Keep quiet when shifting to sleep mode.

Safety Tips
Safety Tips
Use only single-phase AC power.
Otherwise, it may cause fire, electric shock or other accidents.
Do not use when the power cord and plug are damaged, or plug is too loose when inserted.
Otherwise, it may cause electric shock, short circuit, fire or other accidents.
Do not bump, damage, excessive bend, stretch, twist, tie, press, or squeeze the power cord.
Otherwise, it may cause fire, electric shock, short circuit or other accidents.
If the power cord is damaged, must call technical service center to repair or call technical
personnel to replace to avoid danger.
The machine must be switched off and the power cord plug must be pulled out when replacing
filter screen, moving or cleaning.
Do not use wet hands to pull plugs, or it may result in accidents such as electric shock, injury or
other accidents.
Seize the plug part when pull out the plug. Do not hard draw the power cord.
Otherwise, it may cause electric shock, short circuit, fire or other accidents.
Please remove the dust on the plug periodically.
Fouling can cause humid and then leakage, which will cause fire, electric shock or other
accidents.
If it is not used for a long time, the plug must be pulled out.
Otherwise, insulation degradation will cause electric shock, leakage, fire or other accidents.
Please do not insert fingers or other objects at inlet scoop and air outlet.
Otherwise, it may cause electric shock, or trigger other failures.
Please do not use the machine in the wet areas such as bathroom or humidifying area.It is easy to
damp.
Otherwise it will cause electric shock or failure.
Please do not use in areas generating lots of smoke (such as the kitchen).
Otherwise, it may cause cracks.
Do not let the machine inbreathe combustible gas or sparks released by cigarettes, incense, etc.
Otherwise, it may cause fire or other accidents.
Do not use gasoline or paint thinner to clean it. Do not spray insecticide on this machine.
Otherwise, it may cause cracks, electric shock, fire or other accidents.
Do not use this product when spray pesticides in the room.
The inside of the machine will accumulate pharmaceutical components, and release from the
outlet, which will affect health.

If you want to remove the dust in the room, it will more effective when put the machine in a lower place.
ƾ
ƾ
ƾ
ƾ
ƾ
ƾ
ƾ
ƾ
ƾ
Attentions
Note in use
Please put in a stable place with smooth air circulation.
ƾ
ƾ
ƾ
ƾ
Otherwise, the machine will fade, and the receiver sensitivity of the remote control will decline.
Do not put the machine outdoors or in a place with direct sunlight.
Otherwise, the receiver sensitivity of the remote control will decline.
Do not close to the lighting equipment.
The heat will cause the machine fading or deformation.
Do not place the machine near heating sources, such as the heater.
Otherwise it is vulnerable to be interfered by electronic wave.
The machine should be 2 meters far from TV, radio, audio, wireless and other objects.
It should be kept at least 10cm far from the wall.
Prolonged use will make the walls dirty. Please paste the plastic paper on the outer wall or
consider other methods, and clean the walls regularly.
Otherwise, it may make curtains dirty and make the machine break down .
Do not put the machine in places where the curtains can touch the inlet scoop and air outlet.
Otherwise, it may cause fire, electric shock, or injury. Please contact Special Service Center of Sinclair electrical product to repair.
Air purifier can not remove carbon monoxide.
Do not reconstruct by yourself. Do not demolish and repair if you are not the technicians.
Take the battery out before it loses effectiveness, and dispose it properly.
Otherwise, it may cause failure.
If you grasp the panel, it may fall and cause damage.
When you move the machine, you must grasp the handle on the back.
If the water enter the machine, it may cause electric shock or failure.
Do not put any water storage containers near the machine, such as fish tank or vase.
Do not sit or stand on the machine. Do not shake the machine or use the machine when it
reclines or inclines.
ƾ
Children should be supervised to ensure that they do not play with the appliance.
This appliance is not intended for use by persons (including children) with reduced physical,
supervision or instruction concerning use of the appliance by a person responsible for their safety.
sensory or mental capabilities, or lack of experience and knowledge, unless they have been given

Filternetzkomponenten
Filter Components
(Cotton filter, HIMOP + HEPA filter components)
Panel
Dust Frame
Activated carbon net rack body
Button
HIMOP net rack
Filter screen
(Activated carbon)
Host display screen
Air inlet
Remote control
On/off
Mode
Odor sensor
Clean/Change
Timer
Running mode
Fan Speed
Lock
Dust sensor
Mute Low High Turbo
Auto Sleep
Anion Odor
Dedust filter
Indicator light
Remote control
receiver window
Dust sensor Odor sensor
On/Off button
Mode button
1.
Partsname
Host computer parts
Host computer parts
Host computer display
2.
AIR PURIFIER

Handle
The remote control placing tank
Power Cord
Air outlet
Plasma and negative
ion generator
ǃPanel
You need open the internal filter to clean, and the machine starts after you close it.
ǃ Filter components
It can remove the larger dust particles, and it is antibacterial and rot resistance.
ǃDust frame
Air inlet
ǃFilter component
ǃActivated carbon filter screen
It can adsorb most smell, and remove the ammonia, acetic acid and other harmful
gases in the air.
Parts function
Functional description of various parts and components
Back
2.
The main ingredients of cotton filter is as cold catalyst, also known as the cold catalyst filter. It can effectively collect
some dust, catalyze and decompose part of the odor. HIMOP + HEPA filter component has functions of unique
adsorption and decomposition, it can efficiently absorb and decompose formaldehyde of low concentration in
particular.

Funktionen der Bauteile
6ǃDust sensor
It can sense the cigarette smoke, pollen, dust and other particulate matter, and detect
the air pollution level.
7ǃButton
On/off button and mode button respectively control the switch and operating mode
of the machine.
8ǃRemote control
Set up the remote control to achieve perfect functional regulation.
9ǃAir inlet
Air inlet
10ǃAir outlet
Clean air blowing outlet
11ǃHandle
Use it when move the machine.
12ǃThe remote control placing tank
It is used to place the remote control.
13ǃPlasma and negative ion generator
The Plasma produced can kill natural bacteria; negative ions produced can refresh
the air.
14ǃPower Cord
It supplies power for the machine, and it has access to single-phase 220-240V~ 50Hz AC.
15ǃOdor sensor
It can sense the different smell of cigarettes and pets, and it also very sensitive to
pesticides, cosmetics, aerosols, alcohol and other odor or sudden changes in
temperature and humidity.
16ǃFan speed indicator
Different indicator shines corresponding to different fan speed.
17ǃTimmer lights
Instruct to set on/off time of the machine.
18ǃReplace the indicating lamp
If the light flashes, it indicates the HIMOP + HEPA filter component is in the
replacement period.
19ǃCleaning lamp
If the light flashes, it indicates filter components need to be cleaned.
20ǃRemote control receiver window
The signal reception is best if the remote control points here.
21ǃMode
It indicates in what mode the machine is running.

Press
Turn off the machine and
unplug the power cord
Remove the dust shelf components
3.
Note˖
5.
1.Remove the panel
2.
6.
4.
Cleanning and maintenance
Cleanning and maintenance
Ć
If it needs dismantling in maintenance, please do it in the following sequence of instructions.
Press the two buckles at both sides of the
bottom of the panel, lift upward, and you
can remove the panel.
Use hands to hold the handle, pull
forward, and remove the dust frame
components.
Take the HIMOP grid out
Pull the handles, pull it out, and take
the HIMOP grid out upward when the
sound "click" is heard.
Remove the activated carbon filter
Install the machine in a reverse order.
Do not scratch the surface when remove the front
panel. Take care of the protruding part on the back,
if which is broken the machine will not operate. Activated carbon filter
The back
of front panel Protruding part Please be careful!
Do not damage it.

Ć
Filter Components Cleaning
2.
Machine Body Cleaning
Sensor
3.
Wash and maintenance
On/off
Mode
Odor sensor
Clean/Change
Timer
Running mode
Fan Speed
Lock
Dust sensor
Mute Low High Turbo
Auto Sleep
Anion Odor
Dedust filter
Dust sensor Odor sensor
Wash and maintenance
1.
Use a vacuum cleaner to remove the dust on the detection port surface of smell sensor and dust sensor.
,QRUGHUWRPDLQWDLQWKHEHVWVWDWHPDFKLQHVVKRXOGEHFOHDQHGUHJXODUO\
'XULQJWKHFOHDQSURFHVVPDFKLQHVVKRXOGEHXQSOXJQRWLQZHWKDQGVZKLFKPD\
FDXVHHOHFWULFVKRFNDQGLQMXULHV
Dirt on the main frames and desks where the main frames are placed should be
clean as often as possible.
After a long time, dirt would be difficult to remove.
• Use soft fabric
Use a dry soft fabric to remove stubborn dirt.
• No volatile substance
Petrol, thinner and abstergent would cause damage to machines.
• No detergent
Chemical composition in the detergent would cause damage to machines.
• No water spraying
Shell and other things should not be flushed or washed.
When the “cleaning” light on the screen of a machine shines, filter components
should be cleaned.
• Use a vacuum cleaner first, then use water to wash the components.
• If the components are very dirty, use neutral household detergent, or after using
the vacuum cleaner, use a cleaning rag or a soft-hair brush, then use water to wash
until no residuum is left.
• After cleaning, fix the filter components again. Press the mode button for 5
seconds in the holding state, time remark would be zero cleaning, and the
“cleaning” light would turn off.
AIR PURIFIER

Blue surface Cotton filter
Maintenance instructions
Attention˖
g
g
g
The maintenance of cotton filter, HIMOP + HEPA
filter components and activated carbon filter
1. The replacement period of cotton filter is different from operating time and placing sites.
Depending on the environment, sometimes you can use more than 1 year, but sometimes
it may also becomes deterioration in a few months.
For example: in non-smoking cases, the life of cotton filter will increase.It is
recommended to replace every 3 months.
2. When the indicator shines, it indicates the user HIMOP + HEPA filter component should
be replaced.
3. Pay attention when you replace the cotton filter. The blue surface should be
outwards,light-colored surface should be next to HIMOP + HEPA filter component.
Then correctly glued cotton filter on HIMOP + HEPA filter components
Remove the HI MOP +
HEPA filter component
4. After HIMOP + HEPA filter component is replaced, all the indicators shines at the same
time,and the "change" light on the screen goes out after the tick sound.
5. The life of activated carbon filter is about 2 ~ 3 years. When there is odor, please remove
the activated carbon filter and place it in the sunlight for 3 ~ 5 hours and then put it back.
If the odor still exists, please replace the activated carbon filter.
6. The maintenance of cotton filter, HIMOP + HEPA filter components and activated
carbon filter, it belongs to consumables, so it is not covered in warranty. There are 3
cotton filters attached to the machine.
The activated carbon filters, filter cotton and HIMOP + HEPA filter components can not be washed with water.
Remove the cotton filter monthly, clean the surface dust, and expose in the sunlight for 3 ~ 5 hours.
Remove the activated carbon filters and HIMOP + HEPA filter components every 3 months, use the vacuum
cleaner or hair dryer to clean the dust accumulating on its surface, and expose in the sunlight for 3 ~ 5 hours.

Maintenance Instruction
If it is not in use for a long term
Replace Battery
1. Please switch off, unplug the power plug, and tie up power cord.
2. Clean each filter part, air inlet, outlet and the host body.
3. Place the carbon filter in a suitable plastic bag, seal it, and put it in the machine.
4. Cover it with dust cover, and place it in a shade and well-ventilated place.
1. Open the back cover of the remote
control according to the arrow direction.
2. Replace it with CR2025 battery, and then
close the lid.
Note:
• The battery should be placed where children can not reach. If a child
accidentally swallow the battery, you should quickly get in touch with
the doctor.
• Before the battery is discarded, please use the tape etc. wrap it at both
ends of positive and negative poles to prevent mixing with other metals
or batteries and causing fever, rupture, fire and so on.
• When the battery is not used any longer, please put it into battery
recycling place at the nearest electrical shop, watch, or camera stores.
• The criteria for replacing battery is 1 year. However, if it is not found
insensitive in receiving signals, please replace the battery.
• Please replace the battery as soon as possible when it is close to the
battery lifespan.
• In order to avoid the failure and injury caused by fluid leakage or rupture,
please remove the battery if it is not in use for a long time.
Battery

Please reaffirm the problems before asking for maintenance.
SymptomsCheckProcessing method
Is the power plugged in? Plug the power supply
There is no air blowing
Thoubleshooting
Is the panel correctly installed?
I Plug the power supply
Can not start
Whether the battery is dead?
The remote control
does not work Are the positive and negative
poles installed reversely?
Does indoor fluorescent light
keep flickering for the reason
of lifespan?
Keep the machine in a distance
from the fluorescent
Install the battery correctly
Replace with new battery
Please contact the after-sales
service in this case
Do not achieved the
cleaning effect
Is it installed in unventilated
areas or are there any obstacles
near the machine?
Is there too much dust on the
filter components, filter cotton
and HIMOP + HEPA filter
components?
Is there too much odor and
smoke produced?
Remove obstacles
Clean the filters, and replace
filter cotton
Clean activated carbon filters
The TV signal is in
interference
Are there any TV, radio within 2
meters away from the machine
or is there any indoor antennas
near the machine?
Are there any power cords or
television sets, radio antenna
which are close to the machine?
Move the TV, radio, and indoor
antennas more than 2 meters
away from the machine.
Keep the power lines or television
sets, radio antenna as far as
possible away from the machine.
It smells in the air outlet
Is there lots of smell released
temporarily? (Many people
smoke or barbecue.)
Is the activated carbon filter not
cleaned or replaced for a long time?
The smell will be gradually
disappearing when the machine
runs for some time.
Maintain the activated carbon filters

Battery
䫕
スᭈ䇗
ࡼ
㞾亢䗳
ࢆ
ᔎⴵ
⾏ᄤ䋳
ᅮᯊ
䰸ᇬ
⬉䴭
ᓖ
䰸
Press
Open and remove the panel
1.
Remove the dust collection frame
2.
Remove HIMOP grid
3.
4.
5.
Install the machine according to reverse order.
6.
Prepare remote control
1.
Use the remote control
2.
Remove the packaging bags before use and
then connect to the power to start the machine.
(Please refer to the picture in operation.)
Remove the cotton filter and HIMOP
+ HEPA filter component
After tearing off the plastic packaging of the
cotton filter and HIMOP + HEPA filter
components, put them into the HIMOP grid.
Open the battery cover on the back of the remote
control, place the battery in the circular tank, pay
attention to positive and negative poles, plug
back the remote control and then it can be used.
• Please put the remote control pointing to the receiver
window in operation.
• The remote control should be used in the effective
range.
• Make sure there is no obstruction between the remote
control and air cleaner, otherwise it will affect the
signal transduction.
Preparation before use
Host computer preparation
Prepare remote control

On/Off
ƽ
On/Off button
Speed button
ƽ
High Low
Speed
Timer button
ƽ
Timer
ƽ
Remote control
Mute
Turbo button
ƽ
Turbo
˄ hour˅
˄hour˅
˄hour˅
Cancel
Ć
You can change the fan speed through the speed button.
Anion
ƽ
Anion button
Ć
Auto
ƽ
Auto button
Ć
ƽ
Ć
Remote Control Operation
Remote Control Operation
Sleep
Sleep button
Odor
Odor button
The perfect functional regulation need to be completed by remote control.
Ć
Electrostatic
ƽ
The button is invalid on this machine.
Electrostatic cleaning
Lock Lum
Auto Speed
Turbo Sleep
Anion Odor
Timer
Electrostatic
On/Off
If it in power state, every time you press the
button, the timing will change according to
the following sequence. And the timing light
of host computer will flash accordingly, then
you can you can select the time.
Note: when it is at power on, the timing is for
timed shutdown; when it at power off, the timing
is for timed power on.
When it is in running state, click the button,
the machine will be in this mode. The
plasma opens, and the fan will run at the
highest speed.
When it is in running state, click the button,
the machine will be in this mode. The
negative ion opens, and the fan will run at
low speed.
You can change the fan speed through the speed button.
When it is in running state, click the button.
The machine automatically adjust mute
fan speed or low speed according to air
quality.
In this mode, the "speed" button is invalid.
When it is in running state, click the button.
The machine automatically adjust the on/off
switch of plasma according to air quality.
In this mode, the "speed" button is invalid.
Click the button when it is in standby mode,
and the machine will begin to run. If you
press it again, the machine will stop running.
When it is in running state, fan speed will
switch according to the following sequence.
And the speed light of host computer will
flash, then you can select the fan speed.
When it is in running state, click the button
and the machine will be in this mode.
Plasma opens, and the fan runs in ultra-
high speed.
High air-flow can quickly remove dust in the
air, and it is easy to use in cleaning the air.

On/off button
Mode button
On/off
Mode
Odor sensor
Clean/Change
Timer
Running mode
Fan Speed
Lock
Dust sensor
Mute Low High Turbo
Auto Sleep
Anion Odor
Dedust filter
Press the "On / Off" button, and the machine starts.
Turbo
Sleep
Auto
Odor
Anion
Master Operation
Master Operation
$XWRüü
Odor —— High fan speed
After it is power on, all the lights on the host would all flash, and then went
out. At this time the machine is in standby mode.
Note: the machine has a function of memorizing unexpected power-down. If the
machine is unexpected power down when it is in operation, it will automatically
return to the state before accidental power failure when the power is on again.
When the remote control is not around, you can use buttons at the central top of the
machine to operate the machine. The buttons at both ends respectively control on/off
and mode switching of the machine.
Press the Mode button, every time you press it the machine switches according to the
following sequence. (The indicator will shine as the mode set.)
Note: this button can not adjust the fan speed. The fan speed runs as the machine
set according to the mode.
Fan speed automatically adjusts according to sensor's test results
of the dust and odor concentration.
Note: if the odor sensors in the initialization state when it is power on
for two minutes at the first time, the odor detection is invalid.
Sleep —— Mute fan speed
Anion —— Low fan speed
Turbo —— Super high fan speed
AIR PURIFIER

Press
Turn off the machine and
unplug the power cord
Remove the dust shelf components
3.
Note˖
5.
1.Remove the panel
2.
6.
4.
Cleanning and maintenance
Cleanning and maintenance
Ć
If it needs dismantling in maintenance, please do it in the following sequence of instructions.
Press the two buckles at both sides of the
bottom of the panel, lift upward, and you
can remove the panel.
Use hands to hold the handle, pull
forward, and remove the dust frame
components.
Take the HIMOP grid out
Pull the handles, pull it out, and take
the HIMOP grid out upward when the
sound "click" is heard.
Remove the activated carbon filter
Install the machine in a reverse order.
Do not scratch the surface when remove the front
panel. Take care of the protruding part on the back,
if which is broken the machine will not operate. Activated carbon filter
The back
of front panel Protruding part Please be careful!
Do not damage it.

Ć
Filter Components Cleaning
2.
Machine Body Cleaning
Sensor
3.
Wash and maintenance
On/off
Mode
Odor sensor
Clean/Change
Timer
Running mode
Fan Speed
Lock
Dust sensor
Mute Low High Turbo
Auto Sleep
Anion Odor
Dedust filter
Dust sensor Odor sensor
Wash and maintenance
1.
Use a vacuum cleaner to remove the dust on the detection port surface of smell sensor and dust sensor.
,QRUGHUWRPDLQWDLQWKHEHVWVWDWHPDFKLQHVVKRXOGEHFOHDQHGUHJXODUO\
'XULQJWKHFOHDQSURFHVVPDFKLQHVVKRXOGEHXQSOXJQRWLQZHWKDQGVZKLFKPD\
FDXVHHOHFWULFVKRFNDQGLQMXULHV
Dirt on the main frames and desks where the main frames are placed should be
clean as often as possible.
After a long time, dirt would be difficult to remove.
• Use soft fabric
Use a dry soft fabric to remove stubborn dirt.
• No volatile substance
Petrol, thinner and abstergent would cause damage to machines.
• No detergent
Chemical composition in the detergent would cause damage to machines.
• No water spraying
Shell and other things should not be flushed or washed.
When the “cleaning” light on the screen of a machine shines, filter components
should be cleaned.
• Use a vacuum cleaner first, then use water to wash the components.
• If the components are very dirty, use neutral household detergent, or after using
the vacuum cleaner, use a cleaning rag or a soft-hair brush, then use water to wash
until no residuum is left.
• After cleaning, fix the filter components again. Press the mode button for 5
seconds in the holding state, time remark would be zero cleaning, and the
“cleaning” light would turn off.
AIR PURIFIER

Blue surface Cotton filter
Maintenance instructions
Attention˖
g
g
g
The maintenance of cotton filter, HIMOP + HEPA
filter components and activated carbon filter
1. The replacement period of cotton filter is different from operating time and placing sites.
Depending on the environment, sometimes you can use more than 1 year, but sometimes
it may also becomes deterioration in a few months.
For example: in non-smoking cases, the life of cotton filter will increase.It is
recommended to replace every 3 months.
2. When the indicator shines, it indicates the user HIMOP + HEPA filter component should
be replaced.
3. Pay attention when you replace the cotton filter. The blue surface should be
outwards,light-colored surface should be next to HIMOP + HEPA filter component.
Then correctly glued cotton filter on HIMOP + HEPA filter components
Remove the HI MOP +
HEPA filter component
4. After HIMOP + HEPA filter component is replaced, all the indicators shines at the same
time,and the "change" light on the screen goes out after the tick sound.
5. The life of activated carbon filter is about 2 ~ 3 years. When there is odor, please remove
the activated carbon filter and place it in the sunlight for 3 ~ 5 hours and then put it back.
If the odor still exists, please replace the activated carbon filter.
6. The maintenance of cotton filter, HIMOP + HEPA filter components and activated
carbon filter, it belongs to consumables, so it is not covered in warranty. There are 3
cotton filters attached to the machine.
The activated carbon filters, filter cotton and HIMOP + HEPA filter components can not be washed with water.
Remove the cotton filter monthly, clean the surface dust, and expose in the sunlight for 3 ~ 5 hours.
Remove the activated carbon filters and HIMOP + HEPA filter components every 3 months, use the vacuum
cleaner or hair dryer to clean the dust accumulating on its surface, and expose in the sunlight for 3 ~ 5 hours.
Other manuals for SP-300A
1
Table of contents
Other Sinclair Air Cleaner manuals