Air Techniques PERI-PRO III User manual

PERI-PRO III
INTRA-ORAL
FILM PROCESSOR
USER’S MANUAL
®
A6732 ISO 13485:1996
ISO 9001:2000
Air Techniques Inc.
Hicksville, NY

CONGRATULATIONS
Since 1977, more than 70,000 Peri-Pro processors have been manufactured and sold
by Air Techniques, making it the processor of choice for the dental profession. This latest
version, the Peri-Pro III, retains the same proven rollerless transport system as earlier mod-
els. This unique system carefully guides the film through the developing process without the
image surface being touched. The Peri-Pro III also offers the same slim space saving
design, with or without a daylight loader, convenient for small office spaces. Where the new
Peri-Pro III differs from previous models is in design features that make maintenance and
operation easier and faster.
The Peri-Pro III processes film, dry-to-dry and ready to read, in only 5 minutes. To
ensure the delivery of consistent film quality, a new heating pad system, located under the
tanks, maintains uniform chemistry bath temperature.
The most significant new design features of the Peri-Pro III are an external water drain
valve in the base and a refill access door built right into the cover. With these new features,
the daily maintenance task of draining and replacing the wash water is accomplished in a
few minutes without removing the processor cover. Just turn the valve to drain the water,
open the refill access door, close the valve, and refill the water tank using the Peri-Pro III
water bottle. By following the Maintenance procedures detailed in this manual, you can
depend on years of reliable service from your Peri-Pro III processor.
TABLE OF CONTENTS
IInnssttaallllaattiioonn
Key Parts Identification ...............................................................................3
Box Contains / Unpack ..............................................................................4
Install & Assemble Processor .......................................................................4-5
OOppeerraattiioonn
Operator Controls .....................................................................................5
Processing film...........................................................................................6-7
MMaaiinntteennaannccee
Daily.........................................................................................................8
Every Two Weeks........................................................................................8-9
Quarterly ..................................................................................................10
TTrroouubblleeSShhoooottiinngg............................................................................................11-14
SSppeecciiffiiccaattiioonnss//DDiimmeennssiioonnss.............................................................................14
AAcccceessssoorriieess.....................................................................................................15
2

3
FILM INLET GRILL
FILM INLET
SHUTTER
DRAIN VALVE
KEY PARTS IDENTIFICATION
COVER
ASSEMBLY
MAINTENANCE
LABEL
OPERATOR
CONTROLS
FILM DELIVERY
RECEPTACLE
AIR OUTLET GRILL
AIR INLET GRILL
TRASH
RECEPTACLE
FILM TRANSPORT
DRYER TRANSPORT
DEVELOPER
TANK
(BLACK)
PCB & TRANSFORMER
COVER
5 AMP FUSE
AIR HOLES
TABS FOR
CARRIERS FILM PACKET
STORAGE
FIG. 1
FIG. 2
DRAIN HOSE
THERMISTOR
ARM
REFILL ACCESS
PANEL
DRYER HEATING ELE-
MENT
ACCESS PANEL
WASH TANK
(WHITE)
FIXER TANK
(RED)
Not shown: Grill inlet cover -
comes installed on the Film Inlet Grill

SHIPPING BOX CONTAINS:
Water bottle with flexible neck attachment
Peri-Pro III Processor base with cover -
NNoottee::Grill Inlet Cover comes installed on the
Film Inlet Grill
Inside the processor:
Film transport
Chemistry tanks ((BBllaacckkddeevveellooppeerr
ttaannkk;;rreeddffiixxeerrttaannkk;;wwhhiitteewwaatteerrttaannkk))
Accessory boxes (3) containing:
##9900885500- 3 ea. Pedo (#0) Film Carrier
2 ea. Bite-wing Film (#3) Carrier
##9900882255- 3 ea. Anterior Film (#1) Carrier
1 ea. Occlusal Film (#4) Carrier
##9900884400- Film receptacle with 3 dividers
Literature kit: Manual, Warranty card
UNPACK
11..Remove the water bottle and flexible neck
attachment from the cardboard packing
found at one end of the box.
22..Place one hand on each side and underneath
the processor. Lift the processor out of the
carton and place it on a flat surface. Remove
the end caps and plastic bag.
33..Remove the processor cover and set aside.
44..Remove the accessory boxes and retain for
future use. Remove the top packing foam.
55..Pull the cardboard insert out of the dryer rack
and set aside; lift the transport out (the trans-
port cannot be removed until the cardboard
insert is removed first).
66..Remove the shipping foam from the back wall
of the processor.
77..Remove the foam cleaning pads from the
chemistry tanks and set aside.
88..Do not remove the clips holding the water
drain tube to the perimeter of the base.
99..Set the base on a flat, level, stable counter.
IImmppoorrttaanntt::TThheessuurrffaacceemmuussttbbeessttaabblleessootthhaatt
cchheemmiissttrryyddo
oeessnnoottssppllaasshhoorrssppiillll..
INSTALLATION
INSTALL PROCESSOR
11..FFiillllTTaannkkss
TThheettaannkkssccaannbbeeiinnssttaalllleeddiinnoorrrreemmoovveeddffrroommtthheebbaasseeoonnllyywwhheenntthheeffiillmmttrraannssppoorrttiissoouuttoofftthhee
pprro
occeessssoorr..IIffyyoouuiinnssttaalllleeddtthheettrraannssppoorrttaafftteerruunnppaacckkiinngg,,rreemmoovveeiittnnooww..
FFoolllloowwtthheettaannkkiinnssttaallllaattiioonn
aannddcchheemmiissttrryyffiilllliinnggsseeqquueenncceebbeelloowwttoopprreevveennttccoonnttaammiinnaattiioonnooff
cchheemmiissttrryydduueettooaacccciiddeennttaallssppiilllliin
nggoorrssppllaasshhiinngg..FFiixxeerriinntthheeddeevveellooppeerrttaannkkwwiillllccaauussee
ccoonnttaammiinnaattiioonn..
PPeerrii--PPrroocchheemmiissttrryysshhoouullddbbeea
attoorrbbeellooww7755°°FF..
Locate the thermistor arm above and to the left of the developer
(black) tank. Carefully lift the arm up, using the finger hole, until it
locks in place. See Fig. 3.
Remove all three tanks and rinse. Note: The wash tank requires
some effort to remove the drain stem with the O-Ring from the drain
receptacle.
Install the wash tank on the right side of the base, making sure the
drain stem with the O-ring seats in the drain receptacle by pushing
down until the tank’s feet rest on the floor of the base. Fill the Peri-
Pro III water bottle to the Fill Line (40 oz.) with room temperature
water (70° - 80°F). Attach the flexible neck to the bottle and flex into
position. Empty entire contents into the water tank.
Install the fixer tank next to the water tank, and fill with contents of the fixer bottle. Pour care-
fully to prevent splashing.
Install the developer tank on the left. Fill with the contents of the developer bottle. Lower the
thermistor arm into the tank.
If chemistry or water is accidentally spilled beneath the chemistry tanks, remove the tanks and
immediately dry the tanks, both sides of the heater plate and the depression in the base and
the area around the heater pad. Reverse the procedure to remove.
4
FIG. 3

PPOOWWEERRSSWWIITTCCHH((AAmmbbeerr))
When the POWER switch is
turned ON it will illuminate,
indicating that there is power to
the processor and the heating
system is on. Turn the POWER
switch OFF at the end of the
day. See Fig. 6A.
TTEEMMPPEERRAATTUURREERREEAADDYY
LLIIGGHHTT((GGrreeeenn))//PPRROOCCEESSSS
SSWWIITTCCHH.
When chemistry reaches its fac-
tory pre-set processing temper-
ature of 75°F, the RREEAADDYYlight
flashes, then remains steady,
indicating that chemistry is at
processing temperature.
Processing is initiated by turn-
ing the PPRROOCCEESSSSswitch OONN.
After processing, the PPRROOC
CEESSSS
switch is turned OOFFFF. The Peri-
Pro remains ready to process
film as long as the PPOOWWEERR
switch is left in the OONNposition
and the green RREEAADDYYlight is
illuminated. See Fig. 6B
RREEFFIILLLLAACCCCEESSSSDDOOOORR
Open the refill access door
when changing and refilling
water, and to check chemistry
levels at the start of the day.
This door must be closed when
processing film. It is closed
when it latches, or snaps, shut.
See Fig. 1 & 5.
FFIILLMMIINNLLEETTSSHHUUTTTTEERR
When the shutter is slid to the
right, it latches in place. Films
drop into the transport and
begin processing automatically
when the transport arms move
into position and the shutter
opens. New batches of film can
be processed every 55 seconds.
5
FIG. 6
FIG. 7
AB
POWER
READY WHEN LIT
PROCESS
22..AAsssseemmbblleePPrroocceessssoorr
Lower the film transport straight into the tanks. The
film transport must sit squarely on the cutouts found
on the top of the vertical plates to the left and right
side of the tanks.
Note: The Transport locks the thermistor into place.
Install the film inlet grill on top of the film transport.
Note that it installs one way: track 1 to the rear and
track 8 to the front of the processor.
Remove the water drain tube from the clips that
hold it to the perimeter of the processor base and push one end of this tube onto the hose
barb part of the drain valve at the right end of the processor. Place the other end of the drain
tube into a receptacle large enough (at least 45 oz.) to hold the contents of the water tank
when it is drained.
Install the processor cover onto the base with
the refill access door in front.
Snap the film dividers (optional installation) into place in the
film delivery receptacle. Hang the film delivery receptacle on
the cutout at the dryer end of the cover.
Plug the line cord into a 115V outlet.
33..CChheecckkOOppeerraattiioonnooffRReeffiillllAAcccceessssDDoooorr
Open the refill access door by firmly pinching the two tabs,
then pulling the door open. There will be some resistance.
Close the panel by pushing it in until it latches (snaps) shut.
OPERATION
OPERATOR CONTROLS
INSTALLATION
FIG. 4
FIG. 5

OPERATION
PROCESSING FILM
DDuupplliiccaattiinnggffiillmmsseexxppoosseeddiinntthheePPeerrii--PPrrooFFiillmmDDuupplliiccaattoorr//DDaayylliigghhttLLooaaddeerraarree
pprroocceesssseeddiinntthheessaamme
emmaannnneerraassrreegguullaarrffiillmmss..
11..Before processing film, open the refill access door to determine whether chemistry in the
developer and fixer tanks are at the Fill Line level as indicated on the inside of the refill access
door. If not, top with water to the Fill Line. Close the refill access door.
22..Turn the PPOOWWEERRswitch OONN. The amber light illuminates, indicating that there is power to the
processor, the heating system is on and the chemistry is being heated. Chemistry heats at a
rate of about 1°F every two to three minutes. For example: chemistry initially at 65°F will
reach set point (75°F) in about 25 minutes.
33..When the chemistry is within 1°F of the pre-set processing temperature, the TTEEMMPPEERRAATTUURREE
RREEAADDYY//PPRROOCCEESSSSlight flickers. When the light remains steady, the factory pre-set temperature
has been reached and the Peri-Pro III is ready to process film. Only process film when the
TTEEMMPPEERRAATTUURREERREEAADDYY//PPR
ROOCCEESSSSlight is on .
44..Turn the PPRROOCCEESSSSswitch OONN. (There is no visual indication, only an audible motor sound
and warm air blowing out of the air outlet grill when processor is in the PPRROOCCEESSSSmode.)
Insert film into the film inlet and slide the shutter to the right until it latches. Film is automatically
processed. A new batch of film can be processed every 55 seconds.
Use the handy removable trash receptacle when stripping covers off film.
The trash receptacle is especially useful when using a Daylight Loader.
PPrroocceessssiinngg##22((AAdduulltt))FFiillmmss
#2 films can be fed directly into the processor
If a film is bent, straighten it.
cc..As soon as the shutter moves back into the original closed position, the next batch of films
may be loaded into the inlet slots and the process repeated.
dd..When the last films to be processed are loaded, place the inlet cover over the film inlet.
The inlet cover prevents film fogging due to light leaks. If a Daylight Loader is being used,
put the inlet cover in place before hands are removed from the cuffs.
NNoottee::The inlet cover comes installed on the grill inlet.
ee..When films have completed the processing cycle, they are delivered into the film delivery
receptacle.
NNoottee::With dividers in place in the film receptacle, the four compartments correspond to slots I &
2, 3 & 4, 5 & 6, 7 & 8 of the film inlet grill. The dividers separate sets of film pairs.
6
aa..Strip the cover off a periapical film and place it into any of the
eight slots of the inlet grill. All 8 slots can be loaded at the same
time if required. Do not put two films into the same slot.
bb..Slide the shutter to the right until it latches. The films drop into the
transport and begin processing when the transport arms automat-
ically move into position and the shutter opens.
FIG. 9

OPERATION
PROCESSING FILM
PPrroocceessssiinngg##00((PPeeddoo))oorr##11((AAdduullttAAnntteerriioorr))FFiillmmss
#0 and #1 films cannot be fed directly into the processor. These films fit into corresponding
# carriers (supplied with the processor), each of which carries the film through the processing
cycle. Up to six #0 or #1 films can be loaded into corresponding carriers at one time.
aa..To load #0 or #1 film into the corresponding # carrier, nest
the carrier inside the tabs on the cover, next to the inlet grill.
bb..Strip the cover off the film(s) and slide the film(s) vertically, one
at a time, into any of the six grooves on the carrier. Push down
firmly until the film touches the cover. Repeat until as many
grooves as required are filled. The films should be standing
vertically and parallel to each other, away from the centerbar.
Make sure that each film on the carrier is in its own groove.
cc..Remove the film inlet grill. (Remember to replace it when processing
#2 films.) Insert the carrier, with the film(s) standing vertically,
into the film inlet.
dd.Slide the shutter to the right until it latches. The carrier will drop into the transport and begin
processing when the shutter automatically opens.
PPrroocceessssiinngg##33((BBiittee--WWiinngg))
FFiillmmss
#3 films cannot be fed directly into the processor. Use a #3 carrier that holds two films at a time.
aa..Strip the cover off one or two #3 film(s) and slide the film(s) horizontally, one at a time,
through both side plates of the #3 carrier. Remove film inlet grill.
bb..Insert the carrier into slots 3 and 6 in the
film inlet. Make sure the edges of the
film(s) clear the side walls of the film inlet.
cc..Slide the shutter to the right until it latches.
The carrier will drop into the transport
and begin processing when the shutter
automatically opens.
PPrroocceessssiinngg##44((OOcccclluussaall))FFiillmmss
aa..Strip the cover off one #4 film and carefully
bend almost in half. Slide the film into
the carrier, making sure both edges of
the film are held in place by the guide
tabs. Remove film inlet grill.
bb..Place the carrier onto the film inlet with
the orientation arrow (on the side of the
carrier) pointing down.
cc..Slide the shutter to the right until it latches. The carrier will drop into the transport and begin
processing when the shutter automatically opens.
55..When processing is completed, turn the PPRROOCCEESSSSswitch OOFFFF. The green RREEAADDYYlight remains
lit. At the end of the day turn the PPOOW
WEERRswitch OOFFFF. Both the green RREEAADDYYlight and the
amber PPOOWWEERRlight will extinguish.
7
FIG. 10
FIG. 11
#0
#1
#3
#4
To assure complete drying of processed # 4 films, a manual assist may be needed,
if so;
1. While the fan is blowing, hold the open end of the film in the carrier directly over the
dryer grille, about 1”- 2” elevation is sufficient, and slowly pivot the carrier to have
warm air blow on the outer surface.
2. 30-60 seconds should be enough time to adequately dry film.
3. Unload the dried film from the carrier when done.

MAINTENANCE
Servicing your Peri-Pro III on a daily, two week and quarterly basis is critical to maintaining quality
processor performance. We recommend the maintenance procedure outlined below, using Formula
2000 cleaner, and Peri-Pro Developer and Fixer, which are specially formulated for Peri-Pro proces-
sors. This maintenance schedule may have to be modified if more frequent cleaning is required.
DDAAIILLYY--CCHHAANNGGEEWWAATTEERR
TTOOPPOOFFFFCCHHEEMMIISSTTRRYYTTAANNKKSSWWIITTHHWWAATTEERRTTOOFFIILLLLLLIINNEE
NNoottee::Remember to place the wash water drain tube into a receptacle
large enough (at least 45 oz.) to hold the contents of the water tank
when it is drained. The best location for the receptacle is on the floor.
Dispose of wash water in accordance with local codes.
11..Turn PPOOWWEERROOFFFF.
22..Find the water drain valve handle at the lower right hand corner of the processor base.
33..Open the drain by turning the handle a full 90° clockwise . Allow the water tank to drain
completely. If the tank interior appears soiled, rinse tank and drain completely.
44..Close the drain valve by turning the handle a full 90° counterclockwise .
55..Fill the Peri-Pro III water bottle to the Fill Line (40 oz.) with room temperature water (70° -
80°F). Extend the neck of the bottle and flex into position. Empty entire contents into the water
(white) tank.
66..Check that the solution in the developer (black) and fixer (red) tanks are up to the Fill Lines as
indicated on the inside of the refill access door. If not, top off the developer and fixer tanks
with water.
77..Close the refill access door to enable the processing of films.
88..Turn PPOOWWEERROONNto prepare for processing.
EEVVEERRYYTTWWOOWWEEEEKKSS((oorreevveerryy330000--335500ffiillmmss))
SSCCRRUUBBTTRRAANNSSPPOORRTT;;CCHHAANNG
GEEPPEERRII--PPRROOCCHHEEMMIISSTTRRYY
CCaauuttiioonn::Cleaning and changing chemistry requires the removal of
the cover and film transport from the Peri-Pro III. Always turn POWER
OFF and unplug the line cord before removing the cover or transport.
SSccrruubbTTrraannssppoorrtt
11..Turn PPOOWWEERROOFFFFand unplug the line cord. Remove the film receptacle, lift off the cover.
22Lift the film transport and let the solutions drip back into the tanks before placing the transport
in a sink. (Use of optional Service Tray PN90121 will contain any dripping chemistry.)
33..Rinse the transport thoroughly with warm water to soften residue and dried chemistry. Be sure
to rinse above the chemistry level, keeping the shutter and the film inlet on the top of the
transport dry. (Use a sink or the transport wash tub that comes with the Transport Cleaning Kit
PN 43975.)
8

MAINTENANCE
44..Scrub grooves inside the transport with a small
brush, paying close attention to the areas just
above the chemistry line, where crystallization
occurs. Rinse to remove deposits. See Fig. 12.
55..Scrub and rinse the gears on the back of the transport.
66..With a dry, lint-free cloth wipe off any moisture
from the shutter and the film inlet area and grill.
IImmppoorrttaanntt::TThheesseeaarreeaassmmuussttbbeeddrryybbeeffoorree
pprroocceessssiinnggffiillmm..
77..Clean the dryer transport rollers if dry, white chem-
istry residue is evident. Follow the procedure
detailed under Quarterly Maintenance #12.
CChhaannggeePPeerrii--PPrrooCChheemmiissttrryy
Change Developer and Fixer every two weeks or
every 300 - 350 films, whichever comes first.
CCaauuttiioonn::NNeevveerrooppeerraatteetthheePPeerrii--PPrrooIIIIIIwwiitthhoouuttlliiqquuiiddiinntthheettaannkkss..
11..Change the water. Follow the steps for changing water under Daily
Maintenance.
If the wash tank is particularly soiled or slimy, it must be thoroughly
cleaned and rinsed. To do this, first remove the film transport.
If the tank was removed, clean and dry the tank drain stem
receptacle in the base.
After cleaning, reinstall the wash tank, making sure the drain stem with the O-ring seats
in the drain receptacle by pushing down straight until the tank’s feet touch the base floor.
22..Carefully lift the thermistor arm up until it locks in place (and remove the transport if it is still
installed). Remove the developer and fixer tanks and dispose of the old chemistry in accor-
dance with local codes.
33..Rinse and, using separate color-coded sponges to avoid possible contamination, clean both
tanks. Rinse again and wipe dry with a lint-free towel.
44..Reinstall the fixer (red) tank in the base. Fill with contents of the Peri-Pro fixer bottle. Pour
carefully to prevent splashing.
55.
.Reinstall the developer (black) tank in the base. Fill with contents of the Peri-Pro developer
bottle. Pour carefully to prevent splashing and possible contamination. Lower the thermistor
arm into place in the developer tank.
NNoottee::Peri- Pro chemistry should be at or below 75°F.
RReeaasssseemmbblleetthheePPeerrii--PPrrooIIIIII
11..Slowly and carefully lower the film transport straight into the tanks. The film transport must sit
squarely on the cutouts found on the top of the vertical plates to the left and right side of the
tanks.
22..Insert the film inlet grill on top of the transport.
33..Install the cover with the refill access door in front. Hang the film delivery receptacle on the
cutout at the dryer end of the cover.
44..Plug the line cord into a 115V outlet and turn the PPOOWWEERRswitch OONN.
9
FIG. 12

10
MAINTENANCE
QQUUAARRTTEERRLLYY--CCLLEEAANNWWIITTHHFFOORRMMUULLAA22000000
Clean the Peri-Pro III Transport with Formula 2000 quarterly or
whenever a black residue is evident on the transport or in the tanks.
UUsseetthheePPeerrii--PPrrooTTrraannssppoorrttCClleeaanniinnggKKiitt((PPNN4433997755))
Each kit contains:
Cleaning tub Brush and cleaning sponges Twin pack of Formula 2000
CCAAUUTTIIOONN::UUsseeiinnaawweellllvveennttiillaatteeddaarreeaa..WWeeaarrpprrootteeccttiivveeccllootthhiinngg,,rruubbbbeerrgglloovveessaannddggoogggglleess..
RReevviieewwtthheeMMaatteerriiaallSSaaffeettyyDDaattaaSShheeeetttthhaattccoommeesswwiitthheevveerryyFFoorrmmuullaa22000000TTwwiinnPPaacckk..
11..Turn the PPOOWWEERROOFFFFand unplug the line cord. Remove the film receptacle; lift the cover off.
2
2..Remove the transport and rinse under running water.
33..Place the transport into the cleaning tub with the gears facing
up .
44..Pour two bottles of Formula 2000 Component 1 into the
cleaning tub. Pour slowly. Do not splash or splatter solution -
wipe up any spills. (Use both bottles of Formula 2000 in the
Twin Pack to insure adequate cleaning of the transport.)
55..Add cold water to the recessed line in the tub.
CCAAUUTTIIOONN::UUsseeccoollddwwaatteerroonnllyy..
66..Sprinkle two powder packets of Component 2 evenly across
the cleaning tub. FFoorrmmuullaa22000000’’sseeffffeerrvveesscceennttcclleeaanniinnggaaccttiioonnwwiilll
lbbeeggiinnaassssoooonnaassCCoommppoonneenntt
22iissaaddddeedd..SSoommeeooddoorraannddvvaappoorrwwiillllbbeeeevviiddeenntt..
77..Soak the transport for approximately 30 minutes, or until the effervescent action stops.
88..Remove the transport and, under cold running water, remove any remaining deposits with the
brush; rinse.
99..DDiissppoosseeooff
tthheecclleeaanniinnggssoolluuttiioonniinnaaccccoorrddaanncceewwiitthhllooccaallccooddeess..Rinse the cleaning tub and
place the transport back in the tub. Fill with fresh water and drain. Rinse and drain at least 2
more times. (Be sure to rinse thoroughly since cleaner residue can contaminate fresh chemistry.)
1100..Place the transport on a towel with the gears facing up and air dry thoroughly. Check that the
shutter area is dry before using. If not, dry with a soft, lint-free towel. See Fig. 14.
1111..Change the water. Follow the steps for changing water under Daily Maintenance. If the wash tank
is particularly soiled or slimy, it must be thoroughly cleaned and rinsed. After cleaning, if the tank
was removed, clean and dry the tank drain stem receptacle in the base,reinstall the wash tank,
making sure the drain stem with the O-ring seats in the drain receptacle by pushing down straight
until the tank’s feet touch the base floor.
1122..Clean the Dryer Transport if dry, white chemistry residue is evident on
the rollers.
Remove the screw holding the dryer front cover plate in place.
Slide the cover plate up, remove it and lift the dryer transport
straight up and out.
Use warm water and a brush to remove the residue; rinse and
completely air dry.
Reinstall the dryer transport and the cover plate.
IImmppoorrttaanntt::TThhiiss
ppllaatteeiissnneecceessssaarryyffoorrpprrooppeerrffiillmmddrryyiinngg..
1133..Change the chemistry. Follow the steps for changing chemistry under Every Two Weeks
Maintenance.
1144..Reinstall the transport and reassemble the Peri-Pro III. Follow the steps for reassembly under Every
Two Weeks Maintenance.
FIG. 13
FIG. 14

TTRROOUUBBLLEESSHHOOOOTTIINNGG
PPRROOBBLLEEMMPPOOSSSSIIBBLLEECCAAUUSSEEPPOOSSSSIIBBLLEESSOOLLUUTTIIOONNSS
1. Film too light. a. Developer exhausted. a. Change chemistry after 300-
350 films or 2 weeks, whichever
comes first.
b. Chemistry does not reach b. Call your authorized Air
factory set temperature. Techniques dealer for service.
c. X-ray machine is c. Call your x-ray dealer for
improperly set or inconsistent. service.
d. Developer is contaminated. d. Dispose of chemistry and clean
with Formula 2000. Replace
chemistry and water.
e. Improper or outdated film. e. Check date on film box.
f. Not using specially f. Use Peri-Pro chemistry to
formulated Peri-Pro assure film quality and archival
chemistry. quality.
2. Film too dark or a. Developer temperature is a. Call you authorized Air
grainy. too high. Techniques dealer for service.
b. X-ray machine is b. Call your x-ray dealer for
improperly set or inconsistent. service.
c. Film has been exposed to c. Check for and correct light
light. leaks in the dark room or
daylight loader. Place the inlet
cover on the film inlet before
leaving the darkroom or before
removing hands from the
daylight loader cuffs.
d. Not using specially d. Use Peri-Pro chemistry to
formulated Peri-Pro assure film quality and archival
chemistry. quality.
3. Film is cloudy or a. Fixer is exhausted. a. Change chemistry after 300-
has brownish surface. 350 films or 2 weeks, whichever
comes first.
b. Fixer temperature is too b. Wait until the ready light
low. stays on continuously, indicating
that the set-point has been
reached.
c. Chemistry does not reach c. Call your authorized Air
factory set temperature. Techniques dealer for service.
d. Improper or outdated film. d. Check date on film box.
Make sure that the film being
used is recommended for
automatic processing.
11
NOTE: Dispose of any chemicals in accordance with local codes.NOTE: Dispose of any chemicals in accordance with local codes.

TTRROOUUBBLLEESSHHOOOOTTIINNGG
PPRROOBBLLEEMMPPOOSSSSIIBBLLEECCAAUUSSEEPPOOSSSSIIBBLLEESSOOLLUUTTIIOONNSS
4. Film is not dry. a. Improper or outdated film. a. Check date on film box.
Make sure that the film being
used is recommended for
automatic processing.
b. Depleted chemistry. b. Change chemistry after 300-
350 film or 2 weeks, whichever
comes first.
c. Contaminated chemistry. c.Dispose of chemistry, clean
with Formula 2000. Replace
chemistry and water.
d. Not using specially d. Use Peri-Pro chemistry to
formulated Peri-Pro assure film quality and archival
chemistry. quality.
e. Defective dryer heater, fan e. Call your authorized Air
motor or thermal fuse. (If air Techniques dealer for service.
is not hot, heater or fuse is
defective.)
f. Dryer air shroud or baffles are f. Call your authorized Air
not in place. Techniques dealer for service.
5. Film has black a. Light fog. a. Check for and correct light
edge at one end. leaks in the dark room or
daylight loader. Put the grill inlet
cover on the film inlet before
leaving the darkroom or before
removing hands from the
daylight loader cuffs.
b. Safe light defective or too
close. Light should be a
minimum of 4 feet away from
the work area.
6. Film has a diagonal or a. Chemistry level is low. The a. Make sure chemistry is at the
curved line through it. entire film is not being Fill Line. If not, top off tank to
covered by chemistry bath as the Fill Line with water.
it travels down into the
chemistry tanks.
b. Chemistry deposits and b. Clean grooves with a soft
crystallization are clogging the toothbrush.
grooves in the transport,
preventing the films from fully
dropping into the chemistry
bath.
c.Timing of the transport c. Contact your authorized Air
arms is out of adjustment. Techniques dealer for service.
12
NOTE: Dispose of any chemicals in accordance with local codes.NOTE: Dispose of any chemicals in accordance with local codes.

TTRROOUUBBLLEESSHHOOOOTTIINNGG
PPRROOBBLLEEMMPPOOSSSSIIBBLLEECCAAUUSSEEPPOOSSSSIIBBLLEESSOOLLUUTTIIOONNSS
7. Developer is black, a. Contaminated developer. a. Tanks and transport must be
has ammonia smell, cleaned with Formula 2000.
there are black Change chemistry.
deposits on the bottom
of the tank, black
streaks or smudges on
film, poor film
density, poor film
clarity.
8. Images or shadows a. Safelight in the darkroom is a. Correct as required.
of other films appear defective or less than 4 feet
on the developed film. from film inlet.
Light is striking films
that were stripped and b. Light is leaking into the b. Correct as required.
stacked on each other dark room.
before being loaded
into the film inlet. Unit with Daylight Loader:
c. 1. Too much light is passing c.1. View glass test: Cover the
through the view glass. view glass, then process film.
c. 2. Light may be leaking
around the daylight loader c.2. Loader cuffs: Inspect for
cuffs. worn or damaged cuffs, replace.
9. Film not exiting. a. Chemistry deposits in a. Clean grooves with a soft
transport grooves cause film to toothbrush.
pop out.
b. Severely bent or jagged b.Straighten film before
film. loading. Insert with rough or burred
end facing up.
c. Film has jagged edge (burr) in c. Proper cleaning of grooves overcomes
solution. this. Use film without jagged edge.
d. Films fed incorrectly. d.Make sure transport is seated
squarely. Put only one film into
a track. Use film inlet grill for
#2 film.
When using a film carrier, load
the carrier so that the film does
not hit the side of the inlet.
e.Transport arms are out of e. Call your authorized Air
alignment. Films will be Techniques dealer for service.
lost constantly, not occasionally.
f. Defective drive motor. f. Call your authorized Air
Techniques dealer for service.
g. Films reach dryer and stay g. Call your authorized Air
there - broken gear teeth or Techniques dealer to replace
missing gear in gear train. defective gears or install missing ones.
13
NOTE: Dispose of any chemicals in accordance with local codes.NOTE: Dispose of any chemicals in accordance with local codes.

10 1/2" 25" 3 1/2"
8 1/2"
15 1/2"
TROUBLE SHOOTING
PPRROOBBLLEEMMPPOOSSSSIIBBLLEECCAAUUSSEEPPOOSSSSIIBBLLEESSOOLLUUTTIIOONNSS
10. Shutter does not a. Broken spring, worn release a. Call your authorized Air
catch, sticks or is bar, defective shutter, shutter Techniques dealer for service.
hard to move. is off tracks, or shutter is
contaminated with chemistry.
11. Processor doesn’t a. Line cord is not plugged in. a. Plug in line cord.
operate.
b. Defective interior fuse or b. Call your authorized Air
switch. Techniques dealer for service.
12. Chemistry does a. Defective thermistor, a. Call your authorized Air
not heat or chemistry defective PC board or
Techniques dealer for service.
gets too hot. defective heater pad, etc.
Otherwise, the Peri-
Pro is functioning.
SPECIFICATIONS DIMENSIONS
DIMENSIONS 25” (L) x 9 3/4” (W) x 8 1/2” (H)
With Daylight Loader
25” (L) x 9 3/4” (W) x 15 3/4” (H)
With Film Duplicator/Daylight Loader
25” (L) x 12 3/4” (W) x 15 3/4” (H)
Add 3 1/2” to length for film receptacle
MINIMUM CLEARANCE Without Daylight Loader - 14 1/2”
TO REMOVE COVER With Daylight Loader or
Film Duplicator/Daylight Loader - 21 3/4”
TANK CAPACITIES Developer and Fixer Tanks - 32 oz. each
Water Tank - 40 oz.
ELECTRICAL REQUIREMENTS 115 Volts, 5 Amps
WEIGHT 28 lbs. ( kg)
14
25”
3 ½“
15 ½“
8½“
10 ½“

ACCESSORIES I OPTIONS
DDEESSCCRRIIPPTTIIOONNPPAARRTTNNUUMMBBEERR
Peri-Pro Transport Cleaning Kit 43975
This kit contains all items needed to
chemically clean a Peri-Pro
Transport:
1 - cleaning tub
1 - brush
1 - twin pack of Formula 2000
Refill for Transport Cleaning Kit 43945
Formula 2000 Twin Pack
Contains 2 bottles of Formula 2000
2 color-coded sponges
Peri-Pro Chemistry 90800
Case contains:
3 one qt. bottles Developer
3 one qt. bottles Fixer
Film Carriers
Pedo (#0) - Box of 5 90980
Adult Anterior (#1) - Box of 5 90985
Bite-Wing (#3) - Box of 5 90990
Occlusal (#4) - Box of 3 90831
Film Duplicator / Daylight Loader 92000
Daylight Loader 90090
Service Tray 90121
15

Peri-Pro is a registered trademark of Air
Techniques
©Air Techniques, Inc. 2004
Peri-Pro III patent No. 5678117
PN 94821 Rev. K
Air Techniques’ products are distributed only through authorized dealers.
1-800-AIR-TECH (1-800-247-8324)
www.airtechniques.com
KAccent Intraoral Digital X-ray Image System
KAcclaim Intraoral Digital Video Camera System
KAirStar®
KGuardianJ Amalgam Collector
KA/T 2000®XR
KPeri-Pro®
KProvecta 70®
KScanX®
KSTSJ
KVacStarJ
Air Techniques is a leading manufacturer of fine dental equipment from air
and vacuum systems and X-ray film processors, to an impressive line of new
products incorporating the most recent technological advances. These new
products, vital components of the innovative dental practice, include intraoral
cameras, digital imaging systems which utilizes phosphor plate technology or
sensor technology and, most recently, an intraoral digital X-ray system.
Air Techniques has been manufacturing quality products for the dental
and medical professional since 1962.