Clarion UNGO ProSecurity S660 User manual

NOTE: This product is intended for installation by a professional installer only!
Any attempt to install this product by any person other than a trained professional
may result in severe damage to a vehicle’s electrical system and components.
PPrrooSSeeccuurriittyy
Model S660
installation guide

22

33
ttaabblleeooffccoonntteennttss
wwaarrnniinngg!!ssaaffeettyyffiirrsstt................................................44
iinnssttaallllaattiioonnppooiinnttssttoorreemmeemmbbeerr................................44
before beginning the installation . . . . . . . . . . . . 4
after the installation . . . . . . . . . . . . . . . . . . . . . 4
ddeecciiddiinnggoonnccoommppoonneennttllooccaattiioonnss..............................55
locations for the siren . . . . . . . . . . . . . . . . . . . . 5
locations for the control module . . . . . . . . . . . . . 5
locations for stinger doubleguard shock sensor . . . 6
locations for valet/program switch . . . . . . . . . . . 7
locations for the status LED . . . . . . . . . . . . . . . . 7
locations for the optional starter kill relay . . . . . . 8
ffiinnddiinnggtthheewwiirreessyyoouunneeeedd........................................88
obtaining constant 12V . . . . . . . . . . . . . . . . . . . 8
finding the 12V switched ignition wire. . . . . . . . . 9
finding the starter wire . . . . . . . . . . . . . . . . . . . 9
finding a (+) parking light wire . . . . . . . . . . . . . 10
finding the door pin switch circuit. . . . . . . . . . . 11
mmaakkiinnggyyoouurrwwiirriinnggccoonnnneeccttiioonnss..............................1122
pprriimmaarryyhhaarrnneessss((HH11)),,1122--ppiinnccoonnnneeccttoorr....................1133
aauuxxiilliiaarryyhhaarrnneessss((HH22)),,66--ppiinnccoonnnneeccttoorr....................1133
ddoooorrlloocckkhhaarrnneessss,,33--ppiinnccoonnnneeccttoorr..........................1144
rriibbbboonnhhaarrnneessss,,wwiirriinnggddiiaaggrraamm................................1144
pprriimmaarryyhhaarrnneessss((HH11))wwiirreeccoonnnneeccttiioonngguuiiddee..............1155
sseeccoonnddaarryyhhaarrnneessss((HH22))wwiirreeccoonnnneeccttiioonngguuiiddee..........2200
pplluugg--iinnLLEEDDaannddvvaalleett//pprrooggrraammsswwiittcchh......................2222
pprrooggrraammmmeerriinntteerrffaaccee,,33--ppiinnbbllaacckkpplluugg....................2222
sshhoocckksseennssoorrhhaarrnneessss,,44--ppiinnccoonnnneeccttoorr......................2233
pprrooggrraammmmiinnggjjuummppeerrss............................................2244
light flash (+)/(-) . . . . . . . . . . . . . . . . . . . . . . 24
ttrraannssmmiitttteerr//rreecceeiivveerrlleeaarrnnrroouuttiinnee™™..........................2244
ttrraannssmmiitttteerrccoonnffiigguurraattiioonnss......................................2266
standard configuration . . . . . . . . . . . . . . . . . . . 26
mmuullttii--lleevveellsseeccuurriittyyaarrmmiinngg......................................2288
ssyysstteemmffeeaattuurreesslleeaarrnnrroouuttiinnee..................................2288
ffeeaattuurreemmeennuuss........................................................3300
menu #1 - basic features . . . . . . . . . . . . . . . . . 30
menu #2 - advanced features . . . . . . . . . . . . . . 31
ffeeaattuurreeddeessccrriippttiioonnss................................................3311
menu #1 - basic features . . . . . . . . . . . . . . . . . 31
menu #2 - advanced features . . . . . . . . . . . . . . 33
nnuuiissaanncceepprreevveennttiioonncciirrccuuiittrryy™™....
............................3355
vvaalleettmmooddee...........................................................
.3355
ttaabblleeooffzzoonneess........................................................3366
lloonnggtteerrmmeevveenntthhiissttoorryy..........................................3366
ttrroouubblleesshhoooottiinngg....................................................3377
alarm troubleshooting . . . . . . . . . . . . . . . . . . . 37
wwiirriinnggqquuiicckkrreeffeerreenncceegguuiiddee....................................3388

44
wwaarrnniinngg!!ssaaffeettyyffiirrsstt
The following safety warnings must be observed at all times:
■Due to the complexity of this system, installation of this product must only be performed by an authorized
Ungo dealer.
iinnssttaallllaattiioonnppooiinnttssttoorreemmeemmbbeerr
■Please read this entire installation guide before beginning the installation. The installation of this remote
start system requires interfacing with many of the vehicle’s systems. Many new vehicles use low-voltage or
multiplexed systems that can be damaged by low resistance testing devices, such as test lights and logic
probes (computer safe test lights). Test all circuits with a high quality digital multi-meter before making con-
nections.
■Do not disconnect the battery if the vehicle has an anti-theft-coded radio. If equipped with an air bag, avoid
disconnecting the battery if possible. Many airbag systems will display a diagnostic code through their
warning lights after they lose power. Disconnecting the battery requires this code to be erased, which can
require a trip to the dealer.
■Check with the customer on status LED location.
■Remove the domelight fuse. This prevents accidentally draining the battery.
■Roll down a window to avoid being locked out of the car.
■Test all functions. The “Using Your System” section of the Owner's Guide is very helpful when testing.
■When testing, don’t forget that this system is equipped with Nuisance Prevention Circuitry™(NPC™). NPC can
bypass trigger zones, making them appear to stop working. See the
Nuisance Prevention Circuitry section.
■Review and complete the
Safety Check section of this guide prior to the vehicle reassembly.
aafftteerrtthheeiinnssttaallllaattiioonn
bbeeffoorreebbeeggiinnnniinnggtthheeiinnssttaallllaattiioonn

55
ddeecciiddiinnggoonnccoommppoonneennttllooccaattiioonnss
SSoommeetthhiinnggssttoorreemmeemmbbeerraabboouuttmmoouunnttiinnggtthheessiirreenn::
■Keep it away from heat sources, such as radiators, exhaust manifolds, turbochargers, and heat shields.
■Mount it where a thief cannot easily disconnect it, whether the hood is open or shut. Both the siren and its
wires should be difficult to find. This usually involves disguising the wire to look like a factory harness.
■We recommend against grounding the siren to its mounting screws. Instead, we recommend running both the
red and black wires into the passenger compartment and grounding to one common point for all devices.
After all, both wires are the same length and come already bonded together. Whenever possible, conceal your
wires in the factory harnesses or in the same style loom as the factory.
■When possible, place the siren on the same side of the vehicle as the control module, where its wires will
reach the control module’s wires without extending them. Always run the wires through the center of a
grommet, never through bare metal!
■Point the siren down so water does not collect in it.
SSoommeetthhiinnggssttoorreemmeemmbbeerraabboouuttwwhheerreetto
ommoouunntttthheeccoonnttrroollmmoodduullee::
■Never put the control module in the engine compartment!
■The first step in hot-wiring a vehicle is removing the driver's side under-dash panel to access the starter and
ignition wires. If the control module is placed just behind the driver's side dash it can easily be disconnected.
■When mounting the control module, try to find a secure location that will not require you to extend the harnesses’
wires (they are 1.5 meters long). Keep it away from the heater core (or any other heat sources) and any obvious leaks.
llooccaattiioonnssffoorrtthheeccoonnttrroollmmoodduullee
llooccaattiioonnssffoorrtthheessiirreenn

66
■The higher the control module is in the vehicle, the better the transmitter range will be. If you put the
control module under a seat or inside a metal dashboard, range will diminish.
Some good control module locations: above the glove box, inside the center console, above the under-dash fuse
box, above the radio, etc.
SSoommeetthhiinnggssttoorreemmeemmbbeerraabboouuttwwhheerreettoommoouunntttthheesshhoocckksseennssoorr::
■Never put the Stinger®in the engine compartment!
■Find a spot close to the control module so that the wires do not need to be extended. Keep it away from the
heater core (or any other heat sources) and any obvious leaks.
HHoowwtthheeSSttiinnggeerr®®iissmmoouunntteeddiisstthheemmoossttiimmppoorrttaannttffaaccttoorriinniittssppeerrffoorrmmaannccee..WWeerreeccoommmmeennddttwwoommeetthhooddss::
■Using double-sided tape or hook-and-loop fastener to mount to a trim panel or an air duct, or
■Wire-tying to a wire harness.
If mounting the sensor where it cannot be easily reached for adjustment, hook-and-loop fastening tape (such as
Velcro) is recommended for ease of removal for future adjustments.
NNOOTTEE::In many vehicles, tying the sensor to a steering column or screwing it to metal will result
in poor sensitivity, especially at the rear of the vehicle.
llooccaattiioonnssffoorrssttiinnggeerrddoouubblleegguuaarrddsshhoocckksseennssoorr

77
IIMMPPOORRTTAANNTT!!When the vehicle is delivered, please show the user where this switch is located
and how to disarm the system with it.
Ensure that the location you pick for the switch has sufficient clearance to the rear. The switch should be well
hidden. It should be placed so passengers or stored items (such as in a glove box or center console) cannot acci-
dentally hit it. The switch fits into a 9/32-inch hole.
This system has Remote Valet. The user can enter and exit Valet® Mode without having to reach the
Valet®/Program switch. This feature was introduced so that switch location was less critical in day-to-day use.
As long as the Valet®/Program switch can be reached to disarm without a transmitter, easy access is not important.
TThhiinnggssttoorreemmeemmbbeerrwwhheennppoossiittiioonniinnggtthheeSSttaattuussLLEEDD::
■It should be visible from both sides and the rear of the vehicle, if possible.
■It needs at least 1/2-inch clearance to the rear.
■It is easiest to remove a small panel, such as a switch blank or a dash bezel, before drilling a 9/32-inch hole.
■Use quick-disconnects near the LED wires if the panel is removable. This lets mechanics or other installers
remove the panel without cutting the wires.
llooccaattiioonnssffoorrtthheessttaattuussLLEEDD
llooccaattiioonnssffoorrvvaalleett//pprrooggrraammsswwiittcchh

88
If optional starter kill relay or its connections are immediately visible upon removal of the under-dash panel,
they can easily be bypassed. Always make the relay and its connections difficult to discern from the factory
wiring! Exposed yellow butt connectors do not look like factory parts, and will not fool anyone! For this reason,
routing the optional starter kill wires away from the steering column is recommended.
ffiinnddiinnggtthheewwiirreessyyoouunneeeedd
Now that you have decided where each component will be located, you’re going to find the wires in the car that
the security system will be connected to.
IIMMPPOORRTTAANNTT!!Do not use a 12V test light or logic probe (computer safe test light) to find these
wires! Use a digital multimeter for all testing.
We recommend two possible sources for 12V constant: the (+) terminal of the battery, or the constant supply to
the ignition switch. Always install a fuse within 12 inches of this connection. If the fuse also will be powering
other circuits, such as door locks, a power window module, a Nite-Lite® headlight control system, etc., fuse
accordingly.
IIMMPPOORRTTAANNTT!!Do not remove the fuse holder on the red wire. It ensures that the control module
has its own fuse, of the proper value, regardless of how many accessories are added to the main
power feed.
oobbttaaiinniinnggccoonnssttaanntt1122VV
llooccaattiioonnssffoorrtthheeooppttiioonnaallssttaarrtteerrkkiillllrreellaayy

99
The ignition wire is powered when the key is in the run or start position. This is because the ignition wire powers
the ignition system (spark plugs, coil) as well as the fuel delivery system (fuel pump, fuel injection computer).
Accessory wires lose power when the key is in the start position to make more current available to the starter motor.
HHoowwttooffiinndd((++))1122VViiggnniittiioonnwwiitthhyyoouurrmmuullttiimmeetteerr::
1. Set to DCV or DC voltage (12V or 20V is fine).
2. Attach the (-) probe of the meter to chassis ground.
3. Probe the wire you suspect of being the ignition wire. The
steering column harness or ignition switch harness is an excel-
lent place to find this wire.
4. Turn the ignition key switch to the run position. If your meter
reads (+)12V, go to the next step. If it doesn’t, probe another
wire.
5. Now turn the key to the start position. The meter display should stay steady, not dropping by more than a
few tenths of a volt. If it drops close to or all the way to zero, go back to Step 3. If it stays steady at (+)12V,
you have found an ignition wire.
ffiinnddiinnggtthhee1122VVsswwiittcchheeddiiggnniittiioonnwwiirree

1100
The (+) parking light wire is often found near the switch. Many cars have the switch built into the turn signal
lever, and in these cars the parking light wire can be found in the steering column. The same wire is often avail-
able in the kick panel or running board.
NNOOTTEE::Many Toyotas, as well as many other Asian vehicles, send a (-) signal from the switch to
a relay. The relay then sends (+)12V to the bulbs. Whenever you have difficulty finding a (+)
parking light wire near the switch, simply test the wires at any switch or control panel which is
lit by the instrument panel lighting. Remember, you need a (+) parking light wire that does not
vary with the dimmer setting.
HHoowwttooffiinnddaa((++))ppaarrkkiinngglliigghhttffllaasshhwwiirreewwiitthhyyoouurrmmuullttiimmeetteerr::
1. Set to DCV or DC voltage (12V or 20V is fine).
2. Attach the (-) probe of the meter to chassis ground.
3. Probe the wire you suspect of being the parking light wire. Usually, the area near the headlight/parking light
switch is an excellent area to start, as is the kick panel.
4. Turn on the parking lights. If your meter shows (+)12V, turn off the parking lights and make sure it goes back
to zero.
5. If it does return to zero, turn the parking lights back on and, using the dash light dimmer control, turn the
brightness of the dash lights up and down. If the meter changes more than a volt when using the dimmer,
look for another wire. If it stays relatively close to (+)12V, you have found your parking light wire.
ffiinnddiinnggaa((++))ppaarrkkiinngglliigghhttwwiirree

1111
TThheebbeessttppllaacceessttooffiinnddtthheeddoooorrsswwiittcchhwwiirreeaarree::
■At the pin switch: When testing at the pin switch, check the wire to ensure that it “sees” all the doors. Often,
the passenger switch will cover all the doors even if the driver’s switch will not.
■At the dome light: This may not be your best choice if the vehicle has delayed domelight supervision, but it
will work in many Hondas, or any vehicle with completely diode-isolated pin switches.
Once you have determined the wire color, the easiest place to connect to the wire is often at the kick panel, at
the windshield pillar, or in the running board. When an easy location is not available, running a wire to the dome-
light itself is often the best solution.
HHoowwttooffiinnddaaddoooorrppiinnsswwiittcchhttrriiggggeerrwwiirree
wwiitthhyyoouurrmmuullttiimmeetteerr::
1. Set to DCV or DC voltage (12V or 20V is fine).
2. In most Fords, fasten the (-) probe of the meter to chassis ground. In most other cars, fasten the (+) probe
of your meter to (+)12V constant.
3. Probe the wire you suspect of being the door trigger wire. If the meter reads (+)12V when any door
is opened, you have found a trigger wire.
NNOOTTEE::Make sure the wire you use “sees” all the doors! Some newer GM vehicles lack standard-
type pin switches. The dome light in these vehicles is turned on when the door handle is lifted.
These usually have a blue/white or white wire coming out of the door into the kick panel which
will provide a (-) trigger for all doors. Some GM vehicles (some Cavaliers, Grand Ams, etc.) have
a yellow wire coming out of the door which provides a (+) door trigger.
ffiinnddiinnggtthheeddoooorrppiinnsswwiittcchhcciirrccuuiitt

1122
mmaakkiinnggyyoouurrwwiirriinnggccoonnnneeccttiioonnss
Before making your connections, plan how your wires will be routed through the vehicle. For instance, the red
12V constant input and the orange ground-when-armed output (for the optional starter kill relay) will often be
routed together to the ignition switch harness. In order to keep the wiring neat and make it harder to find, you
may wish to wrap these wires together in electrical tape or conceal them in tubing similar to what the manu-
facturer used.
There are two acceptable ways of making a wire connection - solder connections and crimp connectors. When
properly performed, either type of connection is reliable and trouble-free. Regardless of whether you solder your
connections or you use mechanical-type crimp-on connections, ensure that all connections are mechanically
sound and that they are insulated.
Cheap electrical tape, especially when poorly applied, is not a reliable insulator. It often falls off in hot weather.
Use good-quality electrical tape or heat shrink.
■Never twist-and-tape the wires together without soldering.
■Never use “fuse taps”, as they can damage fuse box terminals.
If you use tapping connectors such as 3M T-Taps (not to be confused with Scotch-Locks), avoid using them in
higher-current applications (constant 12V, ground, etc.). Some tapping connectors are inferior in quality and
should be avoided.

1133
pprriimmaarryyhhaarrnneessss((HH11)),,1122--ppiinnccoonnnneeccttoorr
______
______
______
______
______
______
______
______
______
______
______
______
aauuxxiilliiaarryyhhaarrnneessss((HH22)),,66--ppiinnccoonnnneeccttoorr
______
______
______
______
______
______ LLIIGGHHTTBBLLUUEE((--))SSEECCOONNDDUUNNLLOOCCKKOOUUTTPPUUTT
WWHHIITTEE//BBLLAACCKKNNOOTTUUSSEEDD
VVIIOOLLEETT//BBLLAACCKK((--))CCHHAANNNNEELL55OOUUTTPPUUTT
GGRREEEENN//WWHHIITTEE((--))PPRROOGGRRAAMMMMAABBLLEECCHHAANNNNEELL44OOUUTTPPUUTT
GGRRAAYY//BBLLAACCKK((--))FFAACCTTOORRYYRREEAARRMM
LLIIGGHHTTGGRREEEENN//BBLLAACCKK((--))FFAACCTTOORRYYDDIISSAARRMM
HH22//11
HH22//22
HH22//33
HH22//44
HH22//55
HH22//66
RREEDD//WWHHIITTEE((--))220000mmAACCHHAANNNNEELL22VVAALLIIDDIITTYYOOUUTTPPUUTT
RREEDD((++))CCOONNSSTTAANNTTPPOOWWEERRIINNPPUUTT
BBRROOWWNN((++))SSIIRREENNOOUUTTPPUUTT
EEMMPPTTYYNNOOTTUUSSEEDD
BBLLAACCKK((--))CCHHAASSSSIISSGGRROOUUNNDDIINNPPUUTT
VVIIOOLLEETT((++))DDOOOORRTTRRIIGGGGEERRIINNPPUUTT,,ZZOONNEE33
BBLLUUEE((--))MMUULLTTIIPPLLEEXXEEDDIINNPPUUTT,,ZZOONNEE44
GGRREEEENN((--))DDOOOORRTTRRIIGGGGEERRIINNPPUUTT,,ZZOONNEE33
BBLLAACCKK//WWHHIITTEE((--))220000mmAADDOOMMEELLIIGGHHTTSSUUPPEERRVVIISSIIOONNOOUUTTPPUUTT
WWHHIITTEE//BBLLUUEENNOOTTUUSSEEDD
WWHHIITTEE((++))//((--))SSEELLEECCTTAABBLLEELLIIGGHHTTFFLLAASSHHOOUUTTPPUUTT
OORRAANNGGEE((--))550000mmAAAARRMMEEDDOOUUTTPPUUTT
HH11//11
HH11//22
HH11//33
HH11//44
HH11//55
HH11//66
HH11//77
HH11//88
HH11//99
HH11//1100
HH11//1111
HH11//1122

1144
ddoooorrlloocckkhhaarrnneessss,,33--ppiinnccoonnnneeccttoorr
______
______
______
rriibbbboonnhhaarrnneessss,,wwiirriinnggddiiaaggrraamm
______
______
______
______
______
______
______
Connect this wire to the (+) 12 volt ignition wire. This wire is pre-wired to the starter kill relay and must show
(+) 12 volts with the key in the RUN position and during cranking. Take care that this wire cannot be shorted
to the chassis at any point.
YYEELLLLOOWW((++))iiggnniittiioonniinnppuutt
YYEELLLLOOWW((++))IIGGNNIITTIIOONNIINNPPUUTTTTOOAALLAARRMM
11
22
33
44
55
66
77
BBLLUUEE((++))LLOOCCKK((--))UUNNLLOOCCKKOOUUTTPPUUTT
EEMMPPTTYYNNOOTTUUSSEEDD
GGRREEEENN((--))LLOOCCKK((++))UUNNLLOOCCKKOOUUTTPPUUTT
11
22
33

1155
pprriimmaarryyhhaarrnneessss((HH11))wwiirreeccoonnnneeccttiioonngguuiiddee
This wire supplies a (-) ground as long as the system is armed. This output ceases as soon as the system is dis-
armed. The orange wire is pre-wired to control the starter kill relay. It can supply up to 500mA of current.
NNOOTTEE::If using the H1/1 Orange wire to activate an add-on accessory such as windo automa-
tion, pager or voice module, a 1-amp diode must be installed to ensure proper operation. Insert
the diode as shown in the following diagram.
IIMMPPOORRTTAANNTT!!Never interrupt any wire other than the starter wire.
HH11//11OORRAANNGGEE((--))ggrroouunndd--wwhheenn--aarrmmeeddoouuttppuutt

1166
As shipped, this wire should be connected to the (+) parking light wire. If the light flash polarity jumper under
the sliding door is moved to the opposite position (see
Internal Programming Jumper section of this guide), this
wire supplies a (-) 200 mA output. This is suitable for driving (-) light control wires in Toyota, Lexus, BMW, some
Mitsubishi, some Mazda, and other model cars.
((++))PPoossiittiivveeLLiigghhttFFllaasshhOOuuttppuutt
((--))LLiigghhttFFllaasshhOOuuttppuutt
NNOOTTEE::For parking light circuits that draw 10 amps or more, the internal jumper must be
switched to a (-) light flash output. (See the Internal Programming Jumper section of this
guide.) PP//NN88661177or a standard automotive SPDT relay must be used on the H1/2 light flash
output harness wire.
HH11//22WWHHIITTEE((++//--))sseelleeccttaabblleelliigghhttffllaasshhoouuttppuutt

1177
Connect this wire to the optional domelight supervision relay as shown below:
IIMMPPOORRTTAANNTT!!This output is only intended to drive a relay. It cannot be connected directly to
the domelight circuit, as the output cannot support the current draw of one or more light bulbs.
Most vehicles use negative door trigger circuits. Connect the green wire to a wire which shows ground when any
door is opened. In vehicles with factory delays on the domelight circuit, there is usually a wire that is unaf-
fected by the delay circuitry. This wire will report Zone 3.
Inputs shorter than 0.8 seconds will trigger the Warn Away response, while inputs longer than 0.8 seconds will
trigger the full alarm sequence. If installing an optional Directed Electronics dual stage sensor, connect both
the blue and the green wires of the optional sensor to this input. This wire will report Zone 4.
HH11//66BBLLUUEE((--))mmuullttiipplleexxiinnppuutt,,zzoonnee44
HH11//55GGRREEEENN((--))ddoooorrttrriiggggeerriinnppuutt,,zzoonnee33
HH11//44BBLLAACCKK//WWHHIITTEE((--))220000mmAAddoommeelliigghhttssuuppeerrvviissiioonnoouuttppuutt

1188
This wire is used in vehicles that have a positive (+) switched dome light circuit. Connect the violet wire to a
wire that shows (+)12V when any door is opened, and ground when the door is closed. This wire will report Zone 3.
Remove any paint and connect this wire to bare metal, preferably with a factory bolt rather than your own screw.
(Screws tend to either strip or loosen with time.) We recommend grounding all your components, including the
siren, to the same point in the vehicle.
Connect this to the red wire of the siren. Connect the black wire of the siren to (-) chassis ground, preferably at
the same point you connected the control module’s black ground wire.
HH11//1100BBRROOWWNN((++))ssiirreennoouuttppuutt
HH11//88BBLLAACCKK((--))cchhaassssiissggrroouunnddccoonnnneeccttiioonn
HH11//77VVIIOOLLEETT((++))ddoooorrttrriiggggeerriinnppuutt,,zzoonnee33

1199
Before connecting this wire, remove the supplied fuse. Connect to the battery positive terminal or the constant
12V supply to the ignition switch.
NNOOTTEE::Always use a fuse within 12 inches of the point you obtain (+)12V. Do not use the 15A
fuse in the harness for this purpose. This fuse protects the module itself.
When the system receives the code controlling Channel 2, for longer than 1.5 seconds, the red/white wire will
supply an output as long as the transmission continues. This is often used to operate a trunk/hatch release or
other relay-driven function.
IIMMPPOORRTTAANNTT!!Never use this wire to drive anything but a relay or a low-current input! The tran-
sistorized output can only supply 200 mA of current. Connecting directly to a solenoid, motor,
or other high-current device will cause it to fail.
HH11//1122RREEDD//WWHHIITTEEcchhaannnneell22,,220000mmAA((--))oouuttppuutt
HH11//1111RREEDD((++))1122VVccoonnssttaannttppoowweerriinnppuutt

2200
sseeccoonnddaarryyhhaarrnneessss((HH22))wwiirreeccoonnnneeccttiioonngguuiiddee
This wire sends a negative pulse every time the remote start is activated or the doors are unlocked. This can be
used to pulse the disarm wire of the vehicle's factory anti-theft device. Use a relay to send a (-) or (+) pulse to
the disarm wire as shown in the following diagrams.
RReellaayyffoorrNNeeggaattiivvee((--))DDiissaarrmmWWiirreeRReellaayyffoorrPPoossiittiivvee((++))DDiissaarrmmWWiirree
This wire sends a negative pulse every time the remote start shuts down or the doors are locked. This can be
used to pulse the arm wire of the vehicle's factory anti-theft device. Use a relay to send a (-) or (+) pulse to the
arm wire.
This wire provides 200 mA programmable output. (See
Feature Descriptions section of this guide.)
IIMMPPOORRTTAANNTT!!Never use this wire to drive anything but a relay or a low-current input! This tran-
sistorized output can only supply 200 mA, and connecting directly to a solenoid, motor, or other
high-current device will cause the module to fail.
This wire provides 200 mA programmable output. (See Feature Descriptions section of this guide.)
IIMMPPOORRTTAANNTT!!Never use this wire to drive anything but a relay or a low-current input! This tran-
sistorized output can only supply 200 mA, and connecting directly to a solenoid, motor, or other
high-current device will cause the module to fail.
HH22//44VVIIOOLLEETT//BBLLAACCKKcchhaannnneell55oouuttppuutt
HH22//33GGRREEEENN//WWHHIITTEE220000mmAA((--))pprrooggrraammmmaabblleecchhaannnneell44oouuttppuutt
HH22//22GGRRAAYY//BBLLAACCKKffaaccttoorryyaallaarrmmrreeaarrmm
HH22//11LLIIGGHHTTGGRREEEENN//BBLLAACCKK((--))ffaaccttoorryyddiissaarrmmoouuttppuutt