GE JB655 User manual
Write the model and serial
numbers here:
Model #_________________
Serial # _________________
You can find them on a label
behind the door or drawer.
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
OWNER’S MANUAL
RANGES
Electric Free-Standing
49-2000927 Rev. 0 07-21 GEA
SAFETY INFORMATION .......... 3
USING THE RANGE
Surface Units........................... 7
Cookware for Radiant Glass Cooktop. . . . . . 9
Oven Controls..........................10
Special Features ........................11
Oven Racks ............................12
Aluminum Foil and Oven Liners...........12
Cookware..............................12
Cooking Modes.........................13
Cooking Guide .........................14
Air Fry Cooking Guide...................15
CARE AND CLEANING
Cleaning the Range – Exterior ............16
Cleaning the Range – Interior ............18
Cleaning the Glass Cooktop .............20
Oven Light............................ 22
Oven Door ............................ 23
Storage Drawer. . . . . . . . . . . . . . . . . . . . . . . . 23
TROUBLESHOOTING TIPS.......24
LIMITED WARRANTY ............26
ACCESSORIES .................... 27
CONSUMER SUPPORT ........... 28
JB655
GE is a trademark of the General Electric Company. Manufactured under trademark license.
249-2000927 Rev. 0
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.
49-2000927 Rev. 0 3
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
ANTI-TIP DEVICE
To reduce the risk of tipping the range,
the range must be secured by a properly
installed anti-tip bracket. See installation
instructions shipped with the bracket for
complete details before attempting to install.
For Free-Standing and Slide-In Ranges
To check if the bracket is installed and
engaged properly, look underneath the
range to see that the rear leveling leg is
engaged in the bracket. On some models, the storage drawer or kick panel
can be removed for easy inspection. If visual inspection is not possible,
slide the range forward, confirm the anti-tip bracket is securely attached to
the floor or wall, and slide the range back so the rear leveling leg is under
the anti-tip bracket.
If the range is pulled from the wall for any reason, always repeat this
procedure to verify the range is properly secured by the anti-tip bracket.
Never completely remove the leveling legs or the range will not be secured
to the anti-tip device properly.
WARNING Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
• A child or adult can tip the range and be killed.
• Install the anti-tip bracket to the wall or floor.
•
Engage the range to the anti-tip bracket by sliding the
range back such that the foot is engaged.
• Re-engage the anti-tip bracket if the range is moved.
• Failure to do so can result in death or serious burns
to children or adults.
Tip-Over Hazard
WARNING
Anti-Tip
Bracket
Leveling Leg
Free-Standing and Slide-In Ranges
WARNING GENERAL SAFETY INSTRUCTIONS
■ Usethisapplianceonlyforitsintendedpurposeas
described in this Owner’s Manual.
■ Haveyourrangeinstalledandproperlygroundedby
a qualified installer in accordance with the provided
installation instructions.
■ Anyadjustmentandserviceshouldbeperformed
only by a qualified installer or service technician.
Do not attempt to repair or replace any part of your
range unless it is specifically recommended in this
manual.
■ Beforeperforminganyservice,unplugtherange
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
■ Donotleavechildrenalone—childrenshouldnot
be left alone or unattended in an area where an
appliance is in use. They should never be allowed
to climb, sit or stand on any part of the appliance.
■ CAUTION Do not store items of interest to
children above a range or on the backguard of a
range—childrenclimbingontherangetoreach
items could be seriously injured.
■ Useonlydrypotholders—moistordamppot
holders on hot surfaces may result in burns from
steam. Do not let pot holders touch hot surface
units or heating elements. Do not use a towel or
other bulky cloth in place of pot holders.
■ Neveruseyourapplianceforwarmingorheating
the room.
■ Besureallpackingmaterialsareremovedfromthe
range before operating to prevent ignition of these
materials.
■ Donotuseanytypeoffoilorlinertocoverthe
oven bottom or anywhere in the oven, except as
described in this manual. Oven liners can trap heat
or melt, resulting in damage to the product and risk
of shock, smoke or fire.
■ Ifaheatingelement,eitheronasurfaceunitorin
the oven, develops a glowing spot or shows other
signs of damage, do not use that area of the range.
A glowing spot indicates the surface unit may fail
and present a potential burn, fire, or shock hazard.
Turn the heating element off immediately and have
it replaced by a qualified service technician.
449-2000927 Rev. 0
WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
Failure to do so may result in fire or personal injury.
■ Donotstoreoruseflammablematerialsinanoven
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
■ Neverwearloose-fittingorhanginggarmentswhile
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
■ Donotletcookinggreaseorotherflammable
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
■ Cleanventilatinghoodsfrequently.Greaseshould
not be allowed to accumulate on the hood or filter.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
■ Donotusewaterongreasefires.Neverpickup
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
tray.Useamulti-purposedrychemicalorfoam-type
fire extinguisher.
■ Ifthereisafireintheovenduringbaking,smother
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
■ Ifthereisafireintheovenduringself-clean,turn
the oven off and wait for the fire to go out. Do not
force the door open. Introduction of fresh air at self-
clean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING GENERAL SAFETY INSTRUCTIONS (Cont.)
■ Donottouchthesurfaceunits,theheatingelements
or the interior surface of the oven. These surfaces
may be hot enough to burn even though they are
dark in color. During and after use, do not touch,
or let clothing or other flammable materials contact
the surface units, areas nearby the surface units or
any interior area of the oven; allow sufficient time
for cooling first. Other surfaces of the appliance
may become hot enough to cause burns. Potentially
hot surfaces include the cooktop, areas facing the
cooktop, oven vent opening, surfaces near the
opening and crevices around the oven door.
■ Donotheatunopenedfoodcontainers.Pressure
could build up and the container could burst,
causing an injury.
■ Avoidscratchingorimpactingglassdoors,cook
tops or control panels. Doing so may lead to glass
breakage. Do not cook on a product with broken
glass. Shock, fire or cuts may occur. Contact a
qualified technician immediately.
■ Cookfoodthoroughlytohelpprotectagainst
foodborne illness. Minimum safe food temperature
recommendations can be found at IsItDoneYet.gov
and fsis.usda.gov.Useafoodthermometertotake
food temperatures and check several locations.
■
Do not allow anyone to climb, stand, or hang on the
oven door, drawer, or cooktop. They could damage
the range or tip it over, causing severe injury or death.
WARNING COOKTOP SAFETY INSTRUCTIONS
■ Never leave the surface units unattended. Boilovers
cause smoking and greasy spillovers that may
ignite.
■ Neverleaveoilunattendedwhilefrying.Ifallowed
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
cabinets.Useadeepfatthermometerwhenever
possible to monitor oil temperature.
■ Toavoidoilspilloverandfire,useaminimum
amount of oil when shallow pan-frying and avoid
cooking frozen foods with excessive amounts of ice.
■ Useproperpansize—selectcookwarehaving
flat bottoms large enough to cover the surface
heating element. The use of undersized cookware
will expose a portion of the surface unit to direct
contact and may result in ignition of clothing. Proper
relationship of cookware to surface unit will also
improve efficiency.
49-2000927 Rev. 0 5
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING OVEN SAFETY INSTRUCTIONS
■ Standawayfromtherangewhenopeningtheoven
door. Hot air or steam which escapes can cause
burns to hands, face and/or eyes.
■ Donotusetheovenifaheatingelementdevelops
a glowing spot during use or shows other signs
of damage. A glowing spot indicates the heating
element may fail and present a potential burn, fire,
or shock hazard. Turn the oven off immediately and
have the heating element replaced by a qualified
service technician.
■ Keeptheovenventunobstructed.
■ Keeptheovenfreefromgreasebuildup.Greasein
the oven may ignite.
■ Placeovenracksindesiredlocationwhileovenis
cool. If rack must be moved while oven is hot, do not
let pot holder contact hot heating element in oven.
■ Whenusingcookingorroastingbagsintheoven,
follow the manufacturer’s directions.
■ Pulltheovenracktothestop-lockpositionwhen
loading and unloading food from the oven. This
helps prevent burns from touching hot surfaces of
the door and oven walls.
■ Donotleaveitemssuchaspaper,cookingutensils
or food in the oven when not in use. Items stored in
an oven can ignite.
■ Neverplacecookingutensils,pizzaorbakingstones,
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.
WARNING COOKTOP SAFETY INSTRUCTIONS
■ Whenusingglass/ceramiccookware,makesureit
is suitable for cooktop service; others may break
because of sudden change in temperature.
■ Tominimizethepossibilityofburns,ignitionof
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby surface units.
■ Whenpreparingflamingfoodsunderahood,turn
the fan on.
■ Ifpowerislosttoanelectriccooktopwhilea
surface unit is ON, the surface unit will turn back on
as soon as power is restored.
■ Intheeventofpowerloss,failuretoturnallsurface
unit knobs to the OFF position may result in ignition
of items on or near the cooktop, leading to serious
injury or death.
■ Donotcookonabrokencooktop.Ifglasscooktop
should break, cleaning solutions and spillovers
may penetrate the broken cooktop and create a
risk of electric shock. Contact a qualified technician
immediately.
■ Avoidscratchingtheglasscooktop.Thecooktop
can be scratched with items such as knives, sharp
instruments, rings or other jewelry, and rivets on
clothing.
■ Donotplaceorstoreitemsthatcanmeltorcatch
fire on the glass cooktop, even when it is not being
used. If the cooktop is inadvertently turned on, they
may ignite. Heat from the cooktop or oven vent after
it is turned off may cause them to ignite also.
■ Useceramiccooktopcleanerandnon-scratch
cleaning pad to clean the cooktop. Wait until the
cooktop cools and the indicator light goes out
before cleaning. A wet sponge or cloth on a hot
surface can cause steam burns. Some cleaners can
produce noxious fumes if applied to a hot surface.
NOTE: Sugar spills are an exception. They should
be scraped off while still hot using an oven mitt
and a scraper. See the Cleaning the glass cooktop
section for detailed instructions.
WARNING RADIANT COOKTOP SAFETY INSTRUCTIONS
Usecarewhentouchingthecooktop.Theglasssurfaceofthecooktopwillretainheatafterthecontrolshave
been turned off. Clean cooktop With Caution – If a wet sponge or cloth is used to wipe spills on a hot cooking
area, be careful to avoid steam burn. Some cleaners can produce noxious fumes if applied to a hot surface.
649-2000927 Rev. 0
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface. Do not use any sharp items to remove the film.
Remove all of the film before using the appliance for the
first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
Consider recycling options for your appliance packaging
material.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING SELF-CLEANING OVEN SAFETY INSTRUCTIONS
The self-cleaning feature operates the oven at temperatures high enough to burn away food soils in the oven.
Follow these instructions for safe operation.
■ Donottouchovensurfacesduringself-clean
operation.Keepchildrenawayfromtheovenduring
self-cleaning. Failure to follow these instructions
may cause burns.
■ Beforeoperatingtheself-cleancycle,removepans,
shiny metal oven racks and other utensils from the
oven. Only gray porcelain-coated oven racks may
be left in the oven. Do not use self-clean to clean
other parts, such as drip pans or bowls.
■ Beforeoperatingtheself-cleancycle,wipegrease
and food soils from the oven. Excessive amount
of grease may ignite leading to smoke damage to
your home.
■ Iftheself-cleaningmodemalfunctions,turnthe
oven off and disconnect the power supply. Have it
serviced by a qualified technician.
■ Donotcleanthedoorgasket.Thedoorgasketis
essential for a good seal. Care should be taken not
to rub, damage or move the gasket.
■ Donotuseaprotectivecoatingtolinetheovenand
do not use commercial oven cleaner unless certified
for use in a self-cleaning oven.
PROPER DISPOSAL OF YOUR APPLIANCE
Dispose of or recycle your appliance in accordance with Federal and Local Regulations. Contact your local
authorities for the environmentally safe disposal or recycling of your appliance.
49-2000927 Rev. 0 7
Throughout this manual, features and appearance may vary from your model.
How to Set
Push the knob in and turn in either direction to the
setting you want.
A surface ON indicator light will glow when any surface
unit is on
For glass cooktop surfaces:
A HOT COOKTOP indicator light will:
■ comeonwhentheunitishottothetouch.
■ stayonevenaftertheunitisturnedoff.
■ stayonuntiltheunitiscooledto
approximately 150°F.
USING THE RANGE:SurfaceUnits
Surface Units
WARNING FIRE HAZARD: Never leave the range unattended with the cooktop on medium or high settings.
Keepflammableitemsawayfromthecooktop.Turnoffallcontrolswhendonecooking.Failureto
follow these instructions can result in fire, serious injury or death.
Dual Surface Units and Control Knobs (on some models)
The surface unit has 2 cooking sizes to select from so
you can match the size of the unit to the size of the
cookware you are using.
At both OFF and HI the control clicks
into position. You may hear slight
clicking sounds during cooking,
indicating the control is maintaining
your desired setting.
Be sure you turn the control knob to
OFF when you finish cooking.
Models with a Dual-Ring
surface element only
Melt setting (on some models)
will melt chocolate or butter.
Using the Warming Zone
WARNING
FOOD POISON HAZARD: Bacteria may grow in food at
temperatures below 140°F.
■ Always start with hot food. Do not use warm setting to
heat cold food.
■ Do not use warm setting for more than 2 hours.
The WARMING ZONE, located in the back center of
the glass surface, will keep hot, cooked food at serving
temperature. Always start with hot food. Do not use to
heat cold food. Placing uncooked or cold food on the
WARMING ZONE could result in foodborne illness.
Turn the control knob to the ON position.
For best results, all foods on the WARMING ZONE
should be covered with a lid or aluminum foil. When
warming pastries or breads, the cover should be vented
to allow moisture to escape.
The initial temperature, type and amount of food, type of
pan, and the time held will affect the quality of the food.
Always use pot holders or oven mitts when removing
food from the WARMING ZONE, since cookware and
plates will be hot.
NOTE: The surface warmer will not glow red like the
cooking elements.
849-2000927 Rev. 0
Surface Units (Cont.)
USING THE RANGE:SurfaceUnits
Home Canning Tips
Be sure the canner is centered over the surface unit.
Make sure the canner is flat on the bottom.
To prevent burns from steam or heat, use caution when
canning.
Userecipesandproceduresfromreputablesources.
These are available from manufacturers such as Ball®
andKerr®and the Department of Agriculture Extension
Service.
Flat-bottomedcannersarerecommended.Useofwater
bath canners with rippled bottoms may extend the time
required to bring the water to a boil.
Temperature Limiter on Radiant Glass Cooktops
Every radiant surface unit has a temperature limiter.
The temperature limiter protects the glass cooktop from
getting too hot.
The temperature limiter may cycle the surface units off
for a time if:
■ thepanboilsdry.
■ thepanbottomisnotflat.
■ thepanisoff-center.
■ thereisnopanontheunit.
Radiant Glass Cooktop
The radiant cooktop features heating units beneath a
smooth glass surface.
NOTE: A slight odor is normal when a new cooktop is
used for the first time. It is caused by the heating of new
parts and insulating materials and will disappear in a
short time.
NOTE: On models with light-colored glass cooktops, it is
normal for the cooking zones to change color when hot
or cooling down. This is temporary and will disappear as
the glass cools to room temperature.
The surface unit will cycle on and off to maintain your
selected control setting.
It is safe to place hot cookware on the glass surface
even when the cooktop is cool.
Even after the surface units are turned off, the glass
cooktop retains enough heat to continue cooking. To
avoid overcooking, remove pans from the surface units
when the food is cooked. Avoid placing anything on the
surface unit until it has cooled completely.
■ Waterstains(mineraldeposits)areremovableusing
the cleaning cream or full-strength white vinegar.
■ Useofwindowcleanermayleaveaniridescentfilmon
the cooktop. The cleaning cream will remove this film.
■ Don’tstoreheavyitemsabovethecooktop.Ifthey
drop onto the cooktop, they can cause damage.
■ Donotusethesurfaceasacuttingboard.
Never cook directly on the glass. Always
use cookware.
Always place the pan in the center of the
surface unit you are cooking on.
Do not slide cookware across the cooktop because
itcanscratchtheglass—theglassisscratch-
resistant, not scratch proof.
49-2000927 Rev. 0 9
USING THE RANGE: Cookware for Radiant Glass Cooktop
Cookware for Radiant Glass Cooktop
The following information will help you choose cookware which will give good performance on glass cooktops.
NOTE: Follow all cookware manufacturer’s recommendations when using any type of cookware on the ceramic cooktop.
Recommended
Stainless Steel
Aluminum:
heavy weight recommended
Good conductivity. Aluminum residues
sometimes appear as scratches on the
cooktop but can be removed if cleaned
immediately. Because of its low melting
point, thin weight aluminum should not
be used.
Copper Bottom:
Copper may leave residues which can
appear as scratches. The residues can
be removed, as long as the cooktop
is cleaned immediately. However, do
not let these pots boil dry. Overheated
metal can bond to glass cooktops. An
overheated copper bottom pot will leave
a residue that will permanently stain the
cooktop if not removed immediately.
Enamel (painted) on Cast Iron:
recommended if bottom of pan is coated
Avoid/Not Recommended
Enamel (painted) on Steel:
Heating empty pans can cause
permanent damage to cooktop glass.
The enamel can melt and bond to the
ceramic cooktop.
Glass-ceramic:
Poor performance. Will scratch the
surface.
Stoneware:
Poor performance. May scratch the
surface.
Cast Iron:
notrecommended—unlessdesigned
specifically for glass cooktops
Poor conductivity and slow to absorb
heat. Will scratch the cooktop surface.
Check pans for flat bottoms by
using a straight edge.
Pans with rounded, curved,
ridged or warped bottoms are
not recommended.
For Best Results
■ Placeonlydrypansonthesurfaceelements.Donot
place lids on the surface elements, particularly wet lids.
Wet pans and lids may stick to the surface when cool.
■ Donotusewoksthathavesupportrings.Thistypeof
wok will not heat on glass surface elements.
■ Werecommendthatyouuseonlyaflat-bottomed
wok. They are available at your local retail store. The
bottom of the wok should have the same diameter as
the surface element to ensure proper contact.
■ Somespecialcookingproceduresrequirespecific
cookware such as pressure cookers or deep-fat
fryers. All cookware must have flat bottoms and be
the correct size.
Do not place wet pans on the glass cooktop.
Do not use woks with support rings on the glass cooktop.
Useflat-bottomedwoksontheglasscooktop.
10 49-2000927 Rev. 0
USING THE RANGE: Oven Controls
Oven Controls
Oven Light 12
2 384 5
1913
11
614
710
1. Convection Cooking (on some models):
Convection cooking modes use increased air
circulation to improve performance. See the Cooking
Modes section for more information.
2. Traditional Cooking Modes: Your oven has
the following traditional cooking modes: Bake and
Broil Hi/Lo. See the Cooking Modes section for more
information.
3. Clean (on some models): Your oven may
have up to two cleaning modes: Self Clean and
Steam Clean. See the Cleaning the Oven section for
important information about using these modes.
4. Start: Must be pressed to start any cooking,
cleaning, or timed function.
5. Cancel/Off: Cancels ALL oven operations except
the clock and timer.
6. + Pad: Short taps to this pad will increase the time
or temperature by small amounts. Touch and hold
the pad to increase the time or temperature by larger
amounts.
7. - Pad: Short taps to this pad will decrease the time
or temperature by small amounts. Touch and hold
the pad to decrease the time or temperature by larger
amounts.
8. Cook Time: Counts down cooking time and turns
off the oven when the cooking time is complete. Press
the Cook Time pad, use the +/-pads to program a
cooking time in hours and minutes, then press Start.
This can only be used with Bake and Convection Bake
(where available).
9. Set Clock: Press +/- keys at the same time once to
turn off the clock display, twice to set time using the +/-
keys individually, and a third time to accept the change
or allow time to be displayed.
10. Timer: Works as a countdown timer. Press the
Timer pad and the +/-pads to program the time in
hours and minutes. Press the Start pad. The timer
countdown is complete. To turn the timer off press the
Timer pad.
11. Delay Time: Delays when the oven will turn on.
Usethistosetatimewhenyouwanttheoventostart.
Press the Delay Time pad and use the +/-pads to
program the time of day for the oven to turn on then
press Start. Press the desired cooking mode and
temperature then press Start. A Cook Time may also
be programmed if desired. Follow the directions under
Cook Time for setting this feature. This can only be
used with Bake, Convection Bake and Self-Clean.
NOTE: When using the Delay Time feature, foods that
spoileasily—suchasmilk,eggs,fish,stuffings,poultry
andpork—shouldnotbeallowedtositformorethan
1 hour before or after cooking. Room temperature
promotes the growth of harmful bacteria. Be sure that
the oven light is off because heat from the bulb will
speed harmful bacteria growth.
12. Oven Light: Turns the oven light on or off.
13. Lock Controls (on some models): Locks
out the control so that pressing the pads does not
activate the controls. Press and hold the +/-pads or
the Lock Controls pad, for three seconds to lock or
unlock the control. Cancel/Off is always active, even
when the control is locked.
14. Air Fry (on some models):: Air Fry is a
special, no-preheat, cooking mode that is designed to
produce foods with a crispier exterior than traditional
oven cooking. The Air Fry mode is intended for single
rack cooking only
49-2000927 Rev. 0 11
USING THE RANGE: Special Features
Special Features
There are several different special features on your range. To change the settings of these special features:
■ PresstheBake and Broil pads at the same time and hold for three seconds.
■ “SF”willappearinthedisplay.
■ Selectthefeatureyouwanttochange.
■ Whenthechangehasbeenmade,presstheStart key to save the change and return to the time of day.
Adjust the Oven Temperature
This feature allows the oven baking and convection
baking temperature to be adjusted up to 35ºF hotter
ordownto35ºFcooler.Usethisfeatureifyoubelieve
your oven temperature is too hot or too cold and wish to
change it. This adjustment affects Bake and Convection
Bake modes. No other cooking modes are affected.
Press the Bake pad to enter the temperature adjustment
mode.Anumberbetween35and-35willdisplay.Use
the +/-pads to set the desired temperature adjustment
and use the Bake pad to change between negative and
positive. Press the Start pad to save the temperature
adjustment.
Clock Display
This feature can turn off the time of day display. Press
the Timer On/Off pad to display the time of day (on) or
turn off the time of day display (oFF).
NOTE: For models with a Set Clock pad, the time of
day display cannot be turned off in special features. Exit
special features. To turn the time of day display off on
these models, press the Set Clock pad once and then
the Start pad. To have the display turned back on, press
the Set Clock pad again and then the Start pad.
12-hour auto shut-off and Sabbath
Optionsforthisfeatureare“SAb”,12-hourautoshut-off
“On”and“Off”.
12-hour auto shut-off turns off the oven after 12 hours of
continuous operations.
Sabbath mode disables all sounds (the control will not
beep when a button is pressed), Convection, Broil, Cook
Time, Timer, Clock, and Delay Time functions. Sabbath
mode can only be used with Bake.
NOTE: The oven light comes on automatically (on some
models) when the door is opened and goes off when the
door is closed. The bulb may be removed. See the Oven
Light Replacement section. On models with a light switch
on the control panel, the oven light may be turned on
and left on.
Press the Set Clock pad to view the current setting and
then to change the setting.
For models that use the +/- keys to set the clock, press
the Cook Time pad to view the current setting and then
to change the setting.
TouseSabbathmode,select“SAb”andpressStart. A ]
will appear in the display and the clock will not display.
Once in Sabbath mode, at any time you can press Bake
to start the oven. Note that when programming a bake
in Sabbath mode, the preset starting temperature will
automatically be set to 350°F. Press the + or - pads to
increase or decrease the temperature in 25°F increments
for temperatures between 170°F and 550°F and then
press Start.
No sound will be given when the keys are pressed. At a
random time between 30 seconds and 1 minute, ][, will
appear in the display indicating the oven is running.
If you need to adjust the temperature while baking,
press Bake again. Press the +or -pads to increase
or decrease the temperature in 25°F from the previous
temperature you set to the new baking temperature and
then press Start.
To exit Sabbath mode, make sure that the cooking mode
is turned off. To turn it off, press Cancel/Off. The oven
will immediately turn off. At a random time between
30 seconds and 1 minute, ][ will change to ]indicating
that the cooking mode has turned off. Press and hold
the Bake and Broil pads for 3 seconds to enter special
features, then press Delay Time or Cook Time until
either12-hour“On”or“Off”isinthedisplayandpress
Start.
NOTE: If power outage occurs, the Sabbath mode will
not resume when power is restored.
12 49-2000927 Rev. 0
Recommended rack positions for various types of
foods are provided in the Cooking Guide. Adjusting
rack position is one way to impact cooking results. For
example, if you would prefer darker tops on cakes,
muffins, or cookies, try moving food one rack position
higher. If you find foods are too brown on top try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is at least 1½" between pans to allow
sufficient space for air to flow.
To avoid possible burns, place the racks in the desired
position before you turn the oven on.
USING THE RANGE: Oven Racks / Aluminum Foil and Oven Liners / Cookware
Oven Racks
Cookware
Cookware Guidelines
The material, finish, and size of cookware affect baking
performance.
Dark, coated and dull pans absorb heat more readily
than light, shiny pans. Pans that absorb heat more
readily can result in a browner, crisper, and thicker crust.
If using dark and coated cookware check food earlier
than minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
oven temperature by 25º F next time.
Shiny pans can produce more evenly cooked baked
goods such as cakes and cookies.
Glass and ceramic pans heat slowly but retain heat well.
These types of pans work well for dishes such as pies
and custards.
Air insulated pans heat slowly and can reduce bottom
browning.
Keepcookwarecleantopromoteevenheating.
CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foil may be used to catch spills by placing a sheet on a lower rack, several inches below the food. Do not use more
foilthannecessaryandneverentirelycoveranovenrackwithaluminumfoil.Keepfoilatleast1-1/2”fromovenwalls
to prevent poor heat circulation.
Aluminum Foil and Oven Liners
The number of rack positions may vary by model.
49-2000927 Rev. 0 13
USING THE RANGE: Cooking Modes
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Cooking Guide section for recommendations for specific foods. Remember, your new oven may perform
differently than the oven it is replacing.
Baking Modes
Select a mode for baking based on the type and quantity
of food you are preparing. When preparing baked goods
such as cakes, cookies, and pastries always preheat
the oven first. Follow recipe recommendations for food
placement. If no guidelines are provided, center food in
the oven.
Bake
The bake mode is intended for single rack cooking. This
mode uses heat primarily from the lower element but
also from the upper element to cook food. To use this
mode press the Bake pad, use the +/-pads to set the
desired temperature, and then press Start. Preheating is
generally recommended when using this mode.
Convection Bake
The Convection Bake mode is intended for baking on
multiple racks at the same time. This mode uses heat
from the upper and lower elements, along with air
movement from the convection fan to enhance cooking
evenness. Baking time might be slightly longer for
multiple racks than what would be expected for a single
rack. To use this mode press the Convection Bake
pad, enter a temperature, and then press Start. Always
preheat when using this mode. When baking more
delicate foods like cookies and cakes, it is recommended
to reduce the input temperature by 25°F for improved
cooking performance.
Broiling Modes
Monitorfoodcloselywhilebroiling.Usecautionwhen
broiling on upper rack positions as placing food closer to
the broil element increases smoking, spattering, and the
possibility of fats igniting. For best performance center
food below the broil heating element.
Try broiling foods that you would normally grill. Adjust
rack positions to adjust the intensity of the heat to the
food. Place foods closer to the broil element when a
seared surface and rare interior is desired. Thicker foods
and foods that need to be cooked through should be
broiled on a rack position farther from the broiler or by
using Broil Lo.
Broil Hi
The Broil Hi mode uses intense heat from the upper
element to sear foods. It is recommended that Broil Hi be
donewiththedooropenforimprovedsearing.UseBroil
Hi for thinner cuts of meat and/ or foods you prefer less
done on the interior. To use this mode press the Broil
pad once and then press Start. It is not necessary to
preheat when using this mode.
Broil Lo
The Broil Lo mode uses less intense heat from the upper
element to cook food thoroughly while also producing
surface browning. The door may be closed or open when
usingBroilLo.UseBroilLoforthickercutsofmeatand/
or foods that you would like cooked all the way through.
To use this mode press the Broil pad twice and then
press Start. It is not necessary to preheat when using
this mode.
Air Fry (on some models):
Air Fry is a special, no-preheat, cooking mode that is
designed to produce foods with a crispier exterior than
traditional oven cooking. The Air Fry mode is intended
for single rack cooking only. Select Air Fry, then input
the desired set temperature and press Start. The
temperature can be set between 300°F and 500°F.
Preheating is not recommended for this mode. Follow
traditional oven recipe or package guidelines for set
temperatures and cook times; adjust cook time to
achieve your desired crispness. Additional guidelines
for using this mode can be found in the Air Fry Cooking
Guide.
Cooking Modes
14 49-2000927 Rev. 0
USING THE RANGE: Cooking Guide
Cooking Guide
FOOD TYPE
RECOMMENDED
MODE(S)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer Cakes, sheet cakes, bundt
cakes, muffins, quick breads on a
Single Rack
Bake 4 Useshinycookware.
Layer cakes* on Multiple Racks Bake 3 and 5 Ensure adequate airflow
(see illustration below).
Chiffon cakes (angel food) Bake 1 Useshinycookware.
Cookies, biscuits, scones on a
Single Rack Bake 4 Useshinycookware.
Cookies, biscuits, scones on
Multiple Racks
Bake
Convection Bake (if available) 3 and 5 Ensure adequate airflow. Reduce input temperature
by 25°F when using Convection Bake only.
Beef & Pork
Hamburgers Broil Hi 6
Useabroilpan;movefooddownformore
doneness/less searing. Watch food closely when
broiling. For best performance center food below the
broil heating element
Steaks & Chops Broil Hi 6
Useabroilpan;movefooddownformore
doneness/less searing. Watch food closely when
broiling. For best performance center food below the
broil heating element
Roasts Bake 3 or 4 Usealowsidedpansuchasabroilpan.Preheating
is not necessary
Poultry
Whole chicken Bake 3 or 4 Usealowsidedpansuchasabroilpan.
Bone-in chicken breasts, legs,
thighs
Broil Hi 3 If breaded or coated in sauce avoid Broil Hi modes.
Broil skin side down first. Watch food closely when
broiling. For best performance when broiling, center
food below the broil heating element.
Broil Lo
Bake 3 or 4
Boneless chicken breasts Broil Lo
Bake 3 or 4
If breaded or coated in sauce avoid Broil Hi modes.
Broil skin side down first. Watch food closely when
broiling. For best performance when broiling, center
food below the broil heating element
Whole turkey Bake 2 or 3 Usealowsidedpansuchasabroilpan.
Turkey Breast Bake 2 or 3 Usealowsidedpansuchasabroilpan.
Fish Broil Lo 6 (1/2 thick or less)
5 (>1/2 inch)
Watch food closely when broiling. For best
performance center food below the broil heating
element.
Casseroles Bake 4
Frozen Convenience Foods
Pizza, french fries, tator tots,
chicken nuggets, appetizers on a
Single Rack
Bake 4 Useshinycookware.
Pizza, french fries, tator tots,
chicken nuggets, appetizers on
Multiple Racks
Bake
Convection Bake (if available) 3 and 5 Useshinycookware.Reducinginputtemperatureis
not recommended when using Convection Bake.
*When baking four cake layers at a time, use racks 3
and 5.Place the pans as shown so that one pan is not
directly above another.
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov. Make sure to use a food thermometer
to take food temperatures.
Rack position for baking 4 layer cakes.
49-2000927 Rev. 0 15
USING THE RANGE: Air Fry Cooking Guide
Air Fry is a special, no-preheat, cooking mode that
is designed to produce foods with a crispier exterior
than traditional oven cooking. Select Air Fry, then
input the desired set temperature and press Start. The
temperature can be set between 300°F and 500°F.
Air Fry Cookware Guidelines
• Only use broil safe cookware when using Air Fry mode.
• A dark sheet pan is recommended. A dark pan
promotes better browning and crisping.
• Oven baking baskets and baking grids can also be
used. A sheet pan should be placed on the rack below
the foods to catch any drippings when using a baking
basket.
General Tips for Air Fry Mode
• The Air Fry mode is designed for cooking on a single
rack.
• The Air Fry mode is designed to be used without
preheating.
• Rack position 3 is recommended for most foods.
• Foods may cook faster than expected if the oven is
already hot when food is placed in the oven.
• When air frying foods with sauce, it is recommended to
apply the sauce at the end of cooking.
• If foods are browning too quickly, try a lower rack
position or lower oven set temperature.
• For packaged foods, use traditional oven cooking
instructions for set temperature and expected cook
time.
• It is not necessary to flip or stir food during cooking
• Arrange food in a single layer on the pan, do not
overload the pan.
• Always check internal food temperature to confirm
minimum safe temperatures have been reached.
Minimum safe food temperatures can be found on
packages and at IsItDoneYet.gov.
FOOD TYPE
RECOMMENDED
RACK POSITION(S)
RECOMMENDED
SET TEMPERATURES (F°)
RECOMMENDED
COOK TIME (MIN) NOTES
Fresh boneless fish or
poultry pieces, breaded such
as nuggets, tenders, fillets
3 375-400 15-30 Userlowersettemperaturesforlargerpieces.
Useshinycookware.
Fresh bone in
chicken wings 3 375-400 25-40 Salt wings or coat in a dry rub, if using sauce
apply after cooking or toward the end of cooking
Fresh bone in chicken
drumsticks or thighs 3 375-400 30-55 Userlowersettemperaturesforlargerpieces.
Fresh French fries,
thin (< ½ inch) 3 400-425 15-30
Parchment paper is recommended when
preparing fresh French fries. For crispier fries,
toss fries in corn starch or rice flour before
cooking.
Fresh French fries,
thick (> ½ inch) 3 375-400 20-35
Parchment paper is recommended when
preparing fresh French fries. For crispier fries,
toss fries in corn starch or rice flour before
cooking.
Frozen packaged
foods 3
Usetraditionaloven(notAirFry)cookinginstructionsasaguidelineforsettemperatureandcooktime.Additional
cook time beyond recommended package time may be required for some foods. If oven is hot when starting, food
may cook faster than the minimum package time.
Primary recommended cookware
Alternate cookware options
Air Fry Cooking Guide (on some models)
16 49-2000927 Rev. 0
A child or adult can tip the range and be killed.
Verify the anti-tip bracket has been properly installed
and engaged.
Ensure the anti-tip bracket is re-engaged when the range
is moved.
Do not operate the range without the anti-tip bracket in
place and engaged.
Failure to follow these instructions can result in death or
serious burns to children or adults.
Tip-Over Hazard
WARNING
Cleaning the Range – Exterior
CARE AND CLEANING: Cleaning the Range – Exterior
WARNING If your range is removed for cleaning, servicing or any reason, be sure the
anti-tip device is reengaged properly when the range is replaced. Failure to
take this precaution could result in tipping of the range and can result in death
or serious burns to children or adults.
Be sure all controls are off and all surfaces are cool before cleaning any part of the range.
Control Knobs
The control knobs may be removed for easier cleaning.
Make sure the knobs are in the OFF positions and pull
them straight off the stems for cleaning.
The knobs can be cleaned in a dishwasher or they may
also be washed with soap and water. Make sure the
inside of the knobs are dry before replacing.
Replace the knobs, in the OFF position to ensure proper
placement.
Control Lockout (on some models)
If desired, the touch pads may be deactivated before
cleaning.
See Lock Controls in the Oven Controls section in this
manual.
Clean up splatters with a damp cloth.
You may also use a glass cleaner.
Remove heavier soil with warm, soapy water. Do not use
abrasives of any kind.
Reactivate the touch pads after cleaning.
Control Panel
It’s a good idea to wipe the control panel after each use.
Clean with mild soap and water or vinegar and water,
rinse with clean water and polish dry with a soft cloth.
Do not use abrasive cleansers, strong liquid cleansers,
plastic scouring pads or oven cleaners on the control
panel—theywilldamagethefinish.
Oven Exterior
Do not use oven cleaners, abrasive cleansers, strong
liquid cleansers, steel wool, plastic scouring pads, or
cleaning powders on the exterior of the oven. Clean with
a mild soap and water or vinegar and water solution.
Rinse with clean water and dry with a soft cloth. When
cleaning surfaces, make sure that they are at room
temperature and not in direct sunlight.
If stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up immediately. Let hot surfaces
cool, then clean and rinse.
Painted Surfaces
Painted surfaces include the sides of the range and the
door, top of control panel and the drawer front. Clean
these with soap and water or a vinegar and water solution.
Do not use commercial oven cleaners, cleaning powders,
steel wool or harsh abrasives on any painted surface.
Porcelain Enamel Cooktop
The porcelain enamel finish is sturdy but breakable if
misused. This finish is acid-resistant. However, any
acidic foods spilled (such as fruit juices, tomato or
vinegar) should not be permitted to remain on the finish.
If acids spill on the cooktop while it is hot, use a dry paper
towel or cloth to wipe it up right away. When the surface
has cooled, wash with soap and water. Rinse well.
For other spills such as fat spatterings, wash with soap
and water or cleansing powders after the surface has
cooled. Rinse well. Polish with a dry cloth.
49-2000927 Rev. 0 17
Cleaning the Range – Exterior
CARE AND CLEANING: Cleaning the Range – Exterior
Fingerprint Resistant Stainless Steel* (Black Stainless, Slate, Dark Slate, and Painted)
DO NOT use Stainless Steel cleaners on outside surfaces.
IMPORTANT: The use of incorrect products may
damage the outer finish of Fingerprint Resistant
Stainless and Black Stainless models. Please follow
these instructions and use only the appropriate items
below to clean your appliance surfaces.
■ Clean interior/exterior surfaces with warm water, mild
soap or detergent, and a soft or microfiber cloth to
avoid damage.
■ Wipe the appliance surface dry with a soft clean cloth
or microfiber towel to avoid streaking or water spotting.
Stainless Steel Surfaces (on some models)
Do not use a steel wool pad; it will scratch the surface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end
of this manual.
NOTE: DO NOT allow stainless steel cleaner to come
in contact with any plastic parts such as control knobs.
If unintentional contact of cleaners with plastic parts
does occur, clean plastic part with a sponge and mild
detergent mixed with warm water.
DO USE DO NOT USE
■Soft,cleanclothorspongeMicrofibercloth ■Abrasivecloths,papertowels,scrubbingsponges
(with or without soap), scouring or steel wool pads
■
Mild detergent mixed with warm water
■Abrasivepowders,liquids,orsprays
■Windowsprays,ammonia,orbleach
■Citrusorplantoil-basedcleaners
■Acidicorvinegar-basedcleaners
■Ovencleaners
■Alkalinecleaners
■Stainlesssteelcleaners
DO USE DO NOT USE
■Soft,cleanclothorsponge ■Abrasivecloths,scrubbingsponges(withorwithoutsoap),
scouring or steel wool pads
■Milddetergentmixedwithwarmwater
■Approvedstainlesssteelcleaners;
Visit the GE Appliances parts store
for approved stainless steel cleaners:
GEApplianceparts.com or call 877.959.8688
■CleanerswithoxalicacidsuchasBar
KeepersFriendSoftCleanser™canbeused
to remove surface rust, tarnish and small
blemishes on stainless steel surfaces only.
■Abrasivepowdersorsprays
■WindowSpraysorAmmonia
■Citrusorplantoil-basedcleaners
■Acidicorvinegar-basedcleaners
■Ovencleaners
■Cleanerscontainingacetone(propanone)
■AnycleanerwithWARNINGaboutplasticcontact
*Easily wipe away smudges and fingerprints.
18 49-2000927 Rev. 0
The interior of your new oven can be cleaned manually or by using Self Clean modes.
Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration and
should be wiped up immediately. Let hot surfaces cool, then clean and rinse.
Manual Cleaning
Do not use oven cleaners (unless certified for self-
cleaning oven), abrasive cleaners, strong liquid
cleansers, steel wool, scouring pads, or cleaning
powders on the interior of the oven. Clean with a mild
soap and water or vinegar and water solution. Rinse with
clean water and dry with a soft cloth. When cleaning
surfaces, make sure that they are at room temperature.
CARE AND CLEANING: Cleaning the Range – Interior
Cleaning the Range – Interior
Self Clean Mode
Read Self-Cleaning Oven Safety Instructions at the
beginning of this manual before using Self Clean Mode.
Self clean uses very high temperatures to clean the oven
interior. You will need to lock the oven door when using
this feature. Before operating the self-clean cycle, wipe
up grease and soils from the oven. Remove all items
from the oven other than enameled (dark color) racks.
Shiny or silver racks and any cookware or other items
should all be removed from the oven before initiating a
self-clean cycle. Close the door. Latch the door.
NOTE: Never force the latch. If the oven is too hot, you
will not be able to slide the latch. Allow the oven to cool.
Press the Self Clean pad and a default self-clean time
is displayed. The clean time can be changed to any
time between 3:00 and 5:00 hours by using the +/-
pads to enter a different time and pressing Start. For
heavily soiled ovens, the maximum 5 hour clean time is
recommended. If you wish to use the default time, press
the Start pad immediately after pressing the Self Clean
pad. The oven will turn off automatically when the self-
clean cycle is complete. After the oven has cooled down
wipe any ash out of the oven.
We recommend venting your kitchen with an open
window or using a ventilation fan or hood during the first
self-clean cycle.
Soil on the front frame of the range and outside the
gasket on the door will need to be cleaned by hand.
Clean these areas with hot water, soap-filled steel-wool
pads or cleansers such as Soft Scrub®. Rinse well with
clean water and dry.
Do not clean the gasket. The fiberglass material of
the oven door gasket cannot withstand abrasion. It is
essential for the gasket to remain intact. If you notice it
becoming worn or frayed, replace it.
Make sure the oven light bulb cover is in place and the
oven light is off.
IMPORTANT: The health of some birds is extremely
sensitive to the fumes given off during the self-cleaning
cycle of any range. Move birds to another well-
ventilated room.
To Stop a Self-Clean Cycle
Press the Cancel/Off pad. Wait until the oven has cooled
below the locking temperature to unlatch the door. You
will not be able to open the door right away unless the
oven has cooled below the locking temperature.
49-2000927 Rev. 0 19
Cleaning the Range – Interior (Cont.)
CARE AND CLEANING: Cleaning the Range – Interior
Racks
All racks can be washed with warm, soapy water.
Enameled (not shiny) racks can be left in the cavity
during self clean.
Racks may be more difficult to slide, especially after
a self-clean. Put some vegetable oil on a soft cloth or
paper towel and rub onto the left and right edges.
NOTE:Usingothercookingoilswillcauseadiscoloring
or a rust like color residue on the racks and cavity sides.
To clean this residue, use a soap and water or a vinegar
and water solution. Rinse with clean water and dry with a
soft cloth.
Oven Heating Elements
Do not clean the bake element or the broil element. Any
soil will burn off when the elements are heated.
To clean the oven floor, gently lift the bake element.
Clean the oven floor with warm, soapy water.
Wipe up heavy soil on the oven bottom.
Gently lift the bake element
20 49-2000927 Rev. 0
CARE AND CLEANING: Cleaning the Glass Cooktop
Cleaning the Glass Cooktop
To maintain and protect the surface of your glass cooktop,
follow these steps:
1. Before using the cooktop for the first time, clean it
with a ceramic cooktop cleaner. This helps protect the
top and makes cleanup easier.
2. Regular use of ceramic cooktop cleaner will help keep
the cooktop looking new.
3. Shake the cleaning cream well. Apply a few drops of
ceramic cooktop cleaner directly to the cooktop.
4. Useapapertowelornon-scratchcleaningpadfor
ceramic cooktops to clean the entire cooktop surface.
5. Useadryclothorpapertoweltoremoveallcleaning
residue. No need to rinse..
NOTE: It is very important that you DO NOT heat the
cooktop until it has been cleaned thoroughly.
Burned-On Residue
NOTE: DAMAGE to your glass surface may occur if you
use scrub pads other than those recommended.
1. Allow the cooktop to cool.
2. Spread a few drops of ceramic cooktop cleaner on
the entire burned residue area.
3. Usinganon-scratchcleaningpadforceramic
cooktops, rub the residue area, applying pressure as
needed.
4. If any residue remains, repeat the steps listed above
as needed.
5. For additional protection, after all residue has been
removed, polish the entire surface with ceramic
cooktop cleaner and a paper towel.
Heavy, Burned-On Residue
1. Allow the cooktop to cool.
2. Useasingle-edgerazorbladescraperatapproximately
a 45° angle against the glass surface and scrape the
soil. It will be necessary to apply pressure to the razor
scraper in order to remove the residue.
3. After scraping with the razor scraper, spread a few drops
of ceramic cooktop cleaner on the entire burned residue
area.Useanon-scratchcleaningpadtoremoveany
remaining residue.
4. For additional protection, after all residue has been
removed, polish the entire surface with ceramic
cooktop cleaner and a paper towel.
Useanon-scratchcleaningpadfor
ceramic cooktops.
Clean your cooktop after each
spill.Useaceramiccooktop
cleaner.
Ceramic
Cooktop
Cleaner
The ceramic cooktop scraper and all recommended supplies
are available through our Parts Center. See the Accessories
and Consumer Support sections at the end of this manual.
NOTE: Do not use a dull or nicked blade.
Table of contents
Other GE Range manuals
GE
GE PS978STSS User manual
GE
GE JAP02 Operating instructions
GE
GE JGBP33SETSS Manual
GE
GE JA624RNSS User manual
GE
GE JBC17 Training manual
GE
GE Profile PB915DT Manual
GE
GE PB970BMBB User manual
GE
GE Appliances Profile JGB900 Original instructions
GE
GE Appliances JGB850 Operating instructions
GE
GE 164D3333P069 User manual
