8
HDM 40
Indirect measurement
3\WKDJRUHDQPHDVXUHPHQWLVXVHGLQWKHFRQGLWLRQWKDWWKHREMHFWLYHQHHGLQJWREHPHDVXUHGLVFRYHUHGRUKDVQRHIIHFWLYHUHÀHFWLQJ
surface and can’t be measured directly.
Make sure you adhere to the prescribed sequence of measurement:
• All target points must be in a horizontal or vertical plane.
7KHEHVWUHVXOWVDUHDFKLHYHGZKHQWKHLQVWUXPHQWLVURWDWHGDERXWD¿[HGSRLQWHJZLWKWKHSRVLWLRQLQJEUDFNHWIXOO\IROGHGRXWDQG
the instrument placed on a wall) or the instrument is mounted on a tripod.
• The minimum / maximum function can be used. The minimum value must be used for measurements at right angles to the target; the
maximum distance for all other measurements.
Indirect measurement – determing a distance using 2 auxilary measurements. E.g. When height and distance can’t be measured
directly.
Press button (2) 3 times. The symbol is displayed. The distance to be measured is blinking in the symbol triangle.
3UHVVEXWWRQWRWDNHGLVWDQFHPHDVXULQJ7KHUHVXOWLVGLVSOD\HGLQWKH¿UVWOLQH
Press button (1) to take distance measuring .
$IWHUSUHVVLQJEXWWRQWKHUHVXOWLVGLVSOD\HGLQWKH¿UVWOLQH7KHUHVXOWRIWKHIXQFWLRQLVGLVSOD\HGLQWKHVHFRQGOLQH
Indirect measurement – measuring of right-angle edge length (using hypotenuse and right-angle edge length). E.g. When height
and distance can’t be measured directly.
Press button (2) 4 times. The symbol is displayed. The distance to be measured is blinking in the symbol triangle.
3UHVVEXWWRQWRWDNHGLVWDQFHPHDVXULQJK\SRWHQXVH7KHUHVXOWRIWKHIXQFWLRQLVGLVSOD\HGLQWKH¿UVWOLQH
Press button (1) to take distance measuring (either of the other two sides of the triangle) . The result of the measurement is displayed
LQWKH¿UVWOLQH
The result of the measurement is displayed in the second line.
