Cafe CES700M User manual

TM
Write the model and serial numbers here:
Model # _______________________________
Serial # _______________________________
You can find them on a label behind the door
or drawer.
49-2001056 Rev. 0 01-22 GEA
Electric Front Control Ranges
Models: CES700M and CES750M
Contents
Safety Information...............................3
Using the Range
Surface Units ..................................7
Cookware for Radiant Glass Cooktop ..............10
Single Oven Controls ...........................11
Double Oven Controls ..........................12
Options......................................13
Settings .....................................13
Sabbath Mode ................................15
Oven Racks ..................................16
Aluminum Foil and Oven Liners...................16
Cookware ....................................16
Cooking Modes ...............................16
Probe .......................................18
Cooking Guide – Single Oven ....................19
Cooking Guide – Double Oven ...................20
Care And Cleaning
Cleaning the Range – Exterior....................21
Cleaning the Range – Interior ....................22
Glass Cooktop ................................23
Probe .......................................24
Oven Light ...................................25
Oven Doors ..................................26
Removable Storage Drawer......................27
Troubleshooting Tips ...........................28
Limited Warranty ...............................34
Accessories ...................................35
Consumer Support .............................36
Owner's Manual
Español
Para consultar una version en español de este manual de instrucciones,
visite nuestro sitio de internet cafeappliances.com.

249-2001056 Rev. 0
TM
THANK YOU FOR MAKING CAFÉ A PART OF YOUR HOME.
We take pride in the craftsmanship, innovation and design that goes into every Café product, and
we think you will too. Among other things, registration of your appliance ensures that we can deliver
important product information and warranty details when you need them.
Register your Café appliance now online. Helpful websites are available in the Consumer Support
section of this Owner’s Manual. You may also mail in the pre-printed registration card included in the
packing material.

49-2001056 Rev. 0 3
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
WARNING Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
ANTI-TIP DEVICE
To reduce the risk of tipping the range,
the range must be secured by a properly
installed anti-tip bracket. See installation
instructions shipped with the bracket for
complete details before attempting to install.
For Free-Standing and Slide-In Ranges
To check if the bracket is installed and
engaged properly, look underneath the
range to see that the rear leveling leg is
engaged in the bracket. On some models, the storage drawer or kick panel
can be removed for easy inspection. If visual inspection is not possible,
slide the range forward, confirm the anti-tip bracket is securely attached to
the floor or wall, and slide the range back so the rear leveling leg is under
the anti-tip bracket.
If the range is pulled from the wall for any reason, always repeat this
procedure to verify the range is properly secured by the anti-tip bracket.
Never completely remove the leveling legs or the range will not be secured
to the anti-tip device properly.
• A child or adult can tip the range and be killed.
• Install the anti-tip bracket to the wall or floor.
•
Engage the range to the anti-tip bracket by sliding the
range back such that the foot is engaged.
• Re-engage the anti-tip bracket if the range is moved.
• Failure to do so can result in death or serious burns
to children or adults.
Tip-Over Hazard
WARNING
Anti-Tip
Bracket
Leveling Leg
Free-Standing and Slide-In Ranges
WARNING GENERAL SAFETY INSTRUCTIONS
■ Usethisapplianceonlyforitsintendedpurposeas
described in this Owner’s Manual.
■ Besureyourapplianceisproperlyinstalledand
grounded by a qualified installer in accordance with
the provided installation instructions.
■ Donotattempttorepairorreplaceanypartofyour
range unless it is specifically recommended in this
manual. All other servicing should be transferred to
a qualified technician.
■ Beforeperforminganyservice,unplugtherange
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
■ Donotleavechildrenalone—childrenshouldnot
be left alone or unattended in an area where an
appliance is in use. They should never be allowed
to climb, sit or stand on any part of the appliance.
■ CAUTION Do not store items of interest to
children above a range or on the backguard of a
range—childrenclimbingontherangetoreach
items could be seriously injured.
■ Useonlydrypotholders—moistordamppot
holders on hot surfaces may result in burns from
steam. Do not let pot holders touch hot surface
units or heating elements. Do not use a towel or
other bulky cloth in place of pot holders.
■ Neveruseyourapplianceforwarmingorheating
the room.
■ Donottouchthesurfaceunits,theheatingelements
or the interior surface of the oven. These surfaces
may be hot enough to burn even though they are
dark in color. During and after use, do not touch,
or let clothing or other flammable materials contact
the surface units, areas nearby the surface units or
any interior area of the oven; allow sufficient time
for cooling first. Other surfaces of the appliance
may become hot enough to cause burns. Potentially
hot surfaces include the cooktop, areas facing the
cooktop, oven vent opening, surfaces near the
opening and crevices around the oven door.
■ Donotheatunopenedfoodcontainers.Pressure
could build up and the container could burst,
causing an injury.

449-2001056 Rev. 0
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
Failure to do so may result in fire or personal injury.
■ Donotstoreoruseflammablematerialsinanoven
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
■ Neverwearloose-fittingorhanginggarmentswhile
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
■ Donotletcookinggreaseorotherflammable
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
■ Donotusewaterongreasefires.Neverpickup
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
tray. Use a multi-purpose dry chemical or foam-type
fire extinguisher.
■ Ifthereisafireintheovenduringbaking,smother
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
■ Ifthereisafireintheovenduringself-clean,turn
the oven off and wait for the fire to go out. Do not
force the door open. Introduction of fresh air at
self-clean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
WARNING COOKTOP SAFETY INSTRUCTIONS
■ Neverleavethesurfaceunitsunattended.Boilovers
cause smoking and greasy spillovers that may catch
on fire.
■ Neverleaveoilunattendedwhilefrying.Ifallowed
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
cabinets. Use a deep fat thermometer whenever
possible to monitor oil temperature.
■ Toavoidoilspilloverandfire,useaminimum
amount of oil when shallow pan-frying and avoid
cooking frozen foods with excessive amounts of ice.
■ Onlycertaintypesofglass,glass/ceramic,
earthenware or other glazed containers are suitable
for cooktop service; others may break because of
the sudden change in temperature.
■ Tominimizethepossibilityofburns,ignitionof
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby surface units.
WARNING GENERAL SAFETY INSTRUCTIONS (Cont.)
■ Donotuseanytypeoffoilorlinertocoverthe
oven bottom or anywhere in the oven, except as
described in this manual. Oven liners can trap heat
or melt, resulting in damage to the product and risk
of shock, smoke or fire.
■ Avoidscratchingorimpactingglassdoors,cook
tops or control panels. Doing so may lead to glass
breakage. Do not cook on a product with broken
glass. Shock, fire or cuts may occur.
■ Cookmeatandpoultrythoroughly—meattoatleast
an internal temperature of 160°F and poultry to at
least an internal temperature of 180°F. Cooking
to these temperatures usually protects against
foodborne illness.
■ Remote Operation - This appliance is configurable to
allow remote operation at any time. Do not store any
flammable materials or temperature sensitive items
inside, on top or near surface units of the appliance.

49-2001056 Rev. 0 5
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
WARNING GLASS COOKTOP SAFETY INSTRUCTIONS
■ Usecarewhentouchingthecooktop.Theglass
surface of the cooktop will retain heat after the
controls have been turned off.
■ Donotcookonabrokencooktop.Ifglasscooktop
should break, cleaning solutions and spillovers
may penetrate the broken cooktop and create a
risk of electric shock. Contact a qualified technician
immediately.
■ Avoidscratchingtheglasscooktop.Thecooktop
can be scratched with items such as knives, sharp
instruments, rings or other jewelry, and rivets on
clothing.
■ Useceramiccooktopcleanerandanon-scratch
cleaning pad to clean the cooktop. Wait until the
cooktop cools and the indicator light goes out
before cleaning. A wet sponge or cloth on a hot
surface can cause steam burns. Some cleaners can
produce noxious fumes if applied to a hot surface.
NOTE: Sugar spills are an exception. They should
be scraped off while still hot using an oven mitt
and a scraper. See the Cleaning the glass cooktop
section for detailed instructions.
WARNING OVEN SAFETY INSTRUCTIONS
■ Standawayfromtherangewhenopeningtheoven
door. Hot air or steam which escapes can cause
burnstohands,faceand/oreyes.
■ Donotusetheovenifaheatingelementdevelops
a glowing spot during use or shows other signs
of damage. A glowing spot indicates the heating
element may fail and present a potential burn, fire,
or shock hazard. Turn the oven off immediately and
have the heating element replaced by a qualified
service technician.
■ Keeptheovenventunobstructed.
■ Keeptheovenfreefromgreasebuildup.Greasein
the oven may ignite.
■ Placeovenracksindesiredlocationwhileovenis
cool. If rack must be moved while oven is hot, do not
let pot holder contact hot heating element in oven.
■ Pulltheovenracktothestop-lockpositionwhen
loading and unloading food from the oven. This
helps prevent burns from touching hot surfaces of
the door and oven walls.
■ Donotleaveitemssuchaspaper,cookingutensils
or food in the oven when not in use. Items stored in
an oven can ignite.
■ Neverplacecookingutensils,pizzaorbakingstones,
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.
WARNING SELF-CLEANING OVEN SAFETY INSTRUCTIONS
The self-cleaning feature operates the oven at temperatures high enough to burn away food soils in the oven.
Follow these instructions for safe operation.
■ Donottouchovensurfacesduringself-clean
operation.Keepchildrenawayfromtheovenduring
self-cleaning. Failure to follow these instructions
may cause burns.
■ Beforeoperatingtheself-cleancycle,removepans,
shiny metal oven racks and other utensils from the
oven. Only gray porcelain-coated oven racks may
be left in the oven. Do not use self-clean to clean
other parts, such as drip pans or bowls.
■ Beforeoperatingtheself-cleancycle,wipegrease
and food soils from the oven. Excessive amount
of grease may ignite leading to smoke damage to
your home.
■ Iftheself-cleaningmodemalfunctions,turnthe
oven off and disconnect the power supply. Have it
serviced by a qualified technician.
■ Donotcleanthedoorgasket.Thedoorgasketis
essential for a good seal. Care should be taken not
to rub, damage or move the gasket.
■ Donotuseaprotectivecoatingtolinetheovenand
do not use commercial oven cleaner unless certified
for use in a self-cleaning oven.

649-2001056 Rev. 0
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface. Do not use any sharp items to remove the film.
Remove all of the film before using the appliance for the
first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
Consider recycling options for your appliance packaging
material.
Remote Enable Equipment
This device complies with part 15 of the FCC Rules.
Operation is subject to the following two conditions: (1)
This device may not cause harmful interference, and
(2) this device must accept any interference received,
including interference that may cause undesired operation.
The wireless communication equipment installed on this
range has been tested and found to comply with the
limits for a Class B digital device, pursuant to part 15 of
the FCC Rules. These limits are designed to:
(a) provide reasonable protection against harmful
interference in a residential installation. This equipment
generates, uses, and can radiate radio frequency energy
and, if not installed and used in accordance with the
instructions, may cause harmful interference to radio
communications. However, there is no guarantee that
interference will not occur in a particular installation. If
this equipment does cause harmful interference to radio
or television reception, which can be determined by
turning the equipment off and on, the user is encouraged
to try to correct the interference by one or more of the
following measures:
■Reorientorrelocatethereceivingantenna.
■Increasetheseparationbetweentheequipmentand
receiver.
■Connecttheequipmentintoanoutletonacircuit
different from that to which the receiver is connected.
■Consultthedealeroranexperiencedradio/TV
technician for help.
(b) accept any interference received, including interference
that may cause undesired operation of the device.
Note that any changes or modifications to the wireless
communication device installed on this oven that are not
expressly approved by the manufacturer could void the
user’s authority to operate the equipment.
PROPER DISPOSAL OF YOUR APPLIANCE
Dispose of or recycle your appliance in accordance with Federal and Local Regulations. Contact your local
authorities for the environmentally safe disposal or recycling of your appliance.

49-2001056 Rev. 0 7
USING THE RANGE: Surface Units
Surface Units
Operating the Cooktop Elements
WARNING FIRE HAZARD: Never leave the
range unattended with the cooktop on. Keep
flammable items away from the cooktop. Turn off all
controls when done cooking. Failure to follow these
instructions can result in fire, serious injury or death.
Before using the cooktop for the first time, clean it with
ceramic cooktop cleaner. This helps protect the top and
makes cleanup easier.
Turn element(s) On: Touch and hold On/Off pad about
half a second. A chime can be heard with each touch to
any pad.
Power level can be selected in any of the following ways:
1. Swipe the gray arc (on the graphics) to the desired
power level. There is no sensor on the LEDs, or;
2. Touch Anywhere along the gray arc, or;
3. Touch +or -pads to adjust power level, or;
4. Shortcut to Hi: Immediately after turning unit on, touch
the +pad, or;
5. Shortcut to Low: Immediately after turning unit on,
touch the -pad.
NOTE: When changing from a high heat setting to a
lower heat setting, the surface unit may stop glowing.
This is normal. The unit is still on and hot.
NOTE: This cooktop has a rapid heat-up feature. If the
cooktop is cool when turned on, it will glow red for a short
period of time until the desired power setting is reached.
Gray Arc
Swipe Area
LED
Lights
Gray Arc
Swipe Area
OR

849-2001056 Rev. 0
Surface Units (Cont.)
Using the Warming Zone
WARNING
FOOD POISON HAZARD: Bacteria may grow in food at
temperatures below 140°F.
■ Always start with hot food. Do not use warm setting to
heat cold food.
■ Do not use warm setting for more than 2 hours.
The WARMING ZONE, located in the back center of
the glass surface, will keep hot, cooked food at serving
temperature. Always start with hot food. Do not use to
heat cold food. Placing uncooked or cold food on the
WARMING ZONE could result in foodborne illness.
To use the WARMING ZONE:
Press the WARMING ZONE pad, select the desired level
(1, 2 or 3) using the number pads, and press start.
To turn off the WARMING ZONE:
Press the WARMING ZONE pad.
NOTE: Cancel/OffwillNOTturnoffthewarmingzone.
For best results, all foods on the WARMING ZONE
should be covered with a lid or aluminum foil. When
warming pastries or breads, the cover should be vented
to allow moisture to escape.
The initial temperature, type and amount of food, type of
pan, and the time held will affect the quality of the food.
Always use pot holders or oven mitts when removing
food from the WARMING ZONE, since cookware and
plates will be hot.
NOTE: The surface warmer will not glow red.
How To Synchronize Left Elements
Multi-Ring Burner (Can be Dual or Triple)
To Turn On
Hold the Sync Burners pad for about half a second to
connect the two elements. Operate either element as
described in Operating the Cooktop Elements to adjust
power level.
To Turn Off
1. Touch the On/Off pad on either element to turn off
the Sync Burners.
or
2. Touch the Sync Burners to turn both elements off.
To Turn On/Off
1. Touch the On/Off pad for the surface unit.
2. Use the arc or +or –pad to choose the desired power
setting.
3. Touch the Burner Size pad as needed to select the desired
burner size.
The light next to the Burner Size pad indicates which
size the surface unit is on. To turn the surface unit off,
touch the On/Off pad.
USING THE RANGE: Surface Units

49-2001056 Rev. 0 9
Home Canning Tips
Be sure the canner is centered over the surface unit.
Make sure the canner is flat on the bottom.
To prevent burns from steam or heat, use caution when
canning.
Use recipes and procedures from reputable sources.
These are available from manufacturers such as Ball®
andKerr®and the Department of Agriculture Extension
Service.
Flat-bottomed canners are recommended. Use of water
bath canners with rippled bottoms may extend the time
required to bring the water to a boil.
Temperature Limiter on Radiant Glass Cooktops
Every radiant surface unit has a temperature limiter.
The temperature limiter protects the glass cooktop from
getting too hot.
The temperature limiter may cycle the surface units off
for a time if:
■ thepanboilsdry.
■ thepanbottomisnotflat.
■ thepanisoff-center.
■ thereisnopanontheunit.
Radiant Glass Cooktop
The radiant cooktop features heating units beneath a
smooth glass surface.
NOTE: A slight odor is normal when a new cooktop is
used for the first time. It is caused by the heating of new
parts and insulating materials and will disappear in a
short time.
NOTE: On models with light-colored glass cooktops, it is
normal for the cooking zones to change color when hot
or cooling down. This is temporary and will disappear as
the glass cools to room temperature.
The surface unit will cycle on and off to maintain your
selected control setting.
It is safe to place hot cookware on the glass surface
even when the cooktop is cool.
Even after the surface units are turned off, the glass
cooktop retains enough heat to continue cooking. To
avoid overcooking, remove pans from the surface units
when the food is cooked. Avoid placing anything on the
surface unit until it has cooled completely.
■ Waterstains(mineraldeposits)areremovableusing
the cleaning cream or full-strength white vinegar.
■ Useofwindowcleanermayleaveaniridescentfilmon
the cooktop. The cleaning cream will remove this film.
■ Don’tstoreheavyitemsabovethecooktop.Ifthey
drop onto the cooktop, they can cause damage.
■ Donotusethesurfaceasacuttingboard.
Surface Units (Cont.)
Never cook directly on the glass. Always
use cookware.
Always place the pan in the center of the
surface unit you are cooking on.
Do not slide cookware across the cooktop because
itcanscratchtheglass—theglassisscratch-
resistant, not scratch proof.
USING THE RANGE: Surface Units

10 49-2001056 Rev. 0
Cookware for Radiant Glass Cooktop
USING THE RANGE: Cookware for Radiant Glass Cooktop
The following information will help you choose cookware which will give good performance on glass cooktops.
NOTE: Follow all cookware manufacturer’s recommendations when using any type of cookware on the ceramic cooktop.
Recommended
Stainless Steel
Aluminum:
heavy weight recommended
Good conductivity. Aluminum residues
sometimes appear as scratches on the
cooktop but can be removed if cleaned
immediately. Because of its low melting
point, thin weight aluminum should not
be used.
Copper Bottom:
Copper may leave residues which can
appear as scratches. The residues can
be removed, as long as the cooktop
is cleaned immediately. However, do
not let these pots boil dry. Overheated
metal can bond to glass cooktops. An
overheated copper bottom pot will leave
a residue that will permanently stain the
cooktop if not removed immediately.
Enamel (painted) on Cast Iron:
recommended if bottom of pan is coated
Avoid/Not Recommended
Enamel (painted) on Steel:
Heating empty pans can cause
permanent damage to cooktop glass.
The enamel can melt and bond to the
ceramic cooktop.
Glass-ceramic:
Poor performance. Will scratch the
surface.
Stoneware:
Poor performance. May scratch the
surface.
Cast Iron:
notrecommended—unlessdesigned
specifically for glass cooktops
Poor conductivity and slow to absorb
heat. Will scratch the cooktop surface.
Check pans for flat bottoms by
using a straight edge.
Pans with rounded, curved,
ridged or warped bottoms are
not recommended.
For Best Results
■ Placeonlydrypansonthesurfaceelements.Donot
place lids on the surface elements, particularly wet lids.
Wet pans and lids may stick to the surface when cool.
■ Donotusewoksthathavesupportrings.Thistypeof
wok will not heat on glass surface elements.
■ Werecommendthatyouuseonlyaflat-bottomed
wok. They are available at your local retail store. The
bottom of the wok should have the same diameter as
the surface element to ensure proper contact.
■ Somespecialcookingproceduresrequirespecific
cookware such as pressure cookers or deep-fat
fryers. All cookware must have flat bottoms and be
the correct size.
Do not place wet pans on the glass cooktop.
Do not use woks with support rings on the glass cooktop.
Use flat-bottomed woks on the glass cooktop.

49-2001056 Rev. 0 11
1. Convection Cooking Modes: Convection
cooking modes use increased air circulation to
improve performance. See the Cooking Modes
section for more information.
2. Traditional Cooking Modes: Your oven
has the following traditional cooking modes: Bake
and Broil. See the Cooking Modes section for more
information.
3. Clean: Your oven has two cleaning modes: Self
Clean and Steam Clean. See the Cleaning the
Oven section for important information about using
these modes.
4. Start/Enter: Must be pressed to start any
cooking, cleaning, or timed function. Also used to
start the Warming Zone on the cooktop.
5. Cancel/Off: Cancels ALL oven operations
except the clock and timer. Does NOT cancel the
Warming Zone on the cooktop.
6. Timer: Works as a countdown timer. Press the
Timer pad and number pads to program the time in
hours and minutes. Press the Start pad. The timer
countdown is complete. To turn the timer off press
the Timer pad.
7. Oven Light: Turns the oven light on or off.
8. Lock Controls: Locks out the control so that
pressing the pads does not activate the controls.
Press and hold the 0 pad, for three seconds to lock
or unlock the control. Cancel/Off is always active,
even when the control is locked.
9. Options and Settings: The Options and
Settings pads open up more detailed menus in the
display that allow access to additional functions and
cooking modes. For each you select the function in
the display using the associated number pad. You
can exit at any time by pressing the Options or
Settings pad again. See the Settings, Options, and
Cooking Modes Sections for more details.
10. Warm: Warm mode is designed to keep hot foods
hot for up to 3 hours. To use this mode, select
Warm and then Start. Cover foods that need to
remain moist and do not cover foods that should be
crisp. Preheating is not required. Do not use warm
to heat cold food other than crisping crackers, chips
or dry cereal. It is also recommended that food not
be kept warm for more than 2 hours.
11. Proof: Proof maintains a warm environment for
rising yeast-leavened dough. To use this mode
select Proof and then Start. See the Cooking
Modes Sections for more details.
USING THE RANGE: Single Oven Controls
Single Oven Controls
Control button shapes are representative; your oven may have alternate button shapes.
2
3 6 458 9
9
10
11
1
7

12 49-2001056 Rev. 0
1. Upper Oven and Lower Oven:
Designates which oven the controls will operate.
Select an oven before following the steps for
starting a cooking or cleaning mode.
2. Convect: Convection cooking modes use
increased air circulation to improve performance.
See the Cooking Modes section for more
information.
3. Traditional Cooking Modes: Your oven
has the following traditional cooking modes: Bake
and Broil. See the Cooking Modes section for more
information.
4. Clean: Your oven has two cleaning modes: Self
Clean and Steam Clean. See the Cleaning the
Oven section for important information about using
these modes.
5. Start/Enter: Must be pressed to start any
cooking, cleaning, or timed function. Also used to
start the Warming Zone on the cooktop.
6. Cancel/Off: Cancels ALL oven operations
except the clock and timer. Does NOT cancel the
Warming Zone on the cooktop.
7. Timer: Works as a countdown timer. Press the
Timer pad and number pads to program the time in
hours and minutes. Press the Start pad. The timer
countdown is complete. To turn the timer off press
the Timer pad.
8. Oven Light: Turns the oven light on or off.
9. Lock Controls: Locks out the control so that
pressing the pads does not activate the controls.
Press and hold the 0 pad, for three seconds to lock
or unlock the control. Cancel/Off is always active,
even when the control is locked.
10. Options and Settings: The Options and
Settings pads open up more detailed menus in the
display that allow access to additional functions and
cooking modes. For each you select the function in
the display using the associated number pad. You
can exit at any time by pressing the Options or
Settings pad again. See the Settings, Options, and
Cooking Modes Sections for more details.
USING THE RANGE: Double Oven Controls
Double Oven Controls
Control button shapes are representative; your oven may have alternate button shapes.
1
6 4 9 8 5
6
1
2
10
3 7
10

49-2001056 Rev. 0 13
* Compatible Apple or Android devices and home WiFi network required.
Options
USING THE RANGE:Options/Settings
The options pad opens up a menu of more cooking modes when the oven is off. It opens a menu with additional
features if a cooking mode is already in process. You can exit the menu at any time by pressing the Options pad again.
You must first select an oven and a mode (bake, convection bake, convection roast) and then select Options
to get to the following functions.
Cook Time
Counts down cooking time and turns off the oven when
the cooking time is complete. Select a desired cooking
mode. Use the number pads to program a baking
temperature. Press the Options pad and select Cook
Time. Use the number pad to program cook time in hours
and minutes. Then press Start/Enter. This can only
be used with Bake, Convection Bake, and Convection
Roast.
Delay Time
Delays when the oven will turn on. Use this to set a
time when you want the oven to start. Press the desired
cooking mode pad. Use the number pad to program a
baking temperature. Press the Options pad and select
Delay Time. Use the number pads to program the time of
day for the oven to turn on, and then press Start/Enter.
Delay Time is not available with all modes.
NOTE: When using the Delay Time feature, foods that
spoil easily – such as milk, eggs, fish, stuffing, poultry,
and port – should not be allowed to sit for more than
1 hour before or after cooking. Room temperature
promotes the growth of harmful bacteria. Be sure that the
oven light is off because heat from the bulb will speed
harmful bacteria growth.
Oven Probe (Lower oven only on dual
ovens)
NOTE: Only accessible through traditional and
convection cooking modes.
Monitors internal food temperature and turns the oven
off when the food reaches the programmed temperature.
Insert the probe, press the desired cooking mode, and
program the probe temperature. See the Cooking Modes
Section for more information. The probe can only be used
with Bake, Convection Bake, and Convection Roast.
Settings
The Options and Settings pads open up more detailed menus in the display that allow access to additional functions.
For each you select the function in the display using the associated number pad. You can exit at any time by pressing
the Options or Settings pad again.
WiFi Connect and Remote Enable
Your oven is designed to provide you with two-way
communication between your appliance and smart
device. By using the WiFi Connect features, you will
be able to control essential oven operations such as
temperature settings, timers and cooking modes using
your smartphone or tablet.*
Select Settings then Wifi then follow the instructions on
your phone app. It is necessary to turn on WiFi before
using Remote Enable on your oven.
Connecting your WiFi Connect Enabled Oven
What you will need
Your Café oven uses your existing home WiFi network
to communicate between the appliance and your smart
device. In order to setup your Café oven, you will need
to gather some information:
1. You will need to know the Appliance Network
Name and Password to connect to the appliance.
Select Settings then Wifi to display the SSID and
PASSWORD on your control.
2. Have your smart phone or tablet ready with the ability
to access the internet and download apps.
3. You will need to know the password of your home
WiFi router. Have this password ready while you are
setting up your Café oven.
Connect your Café oven
1. On your smart phone or tablet visit
cafeappliances.com/connect to learn more about
connected appliance features and to download the
appropriate app.
2. Follow the app onscreen instructions to connect your
Café oven.
3. Once the process is complete, the connection light
located on your Café oven display will stay on solid
and the app will confirm you are connected.
4. If the connection light does not turn on or is blinking,
follow the instructions on the app to reconnect. If issues
continue, please visit cafeappliances.com/connect for
assistance regarding oven wireless connectivity.

14 49-2001056 Rev. 0
Settings (Cont.)
Wifi Connect (cont.)
To connect additional smart devices, disconnect from
WiFi and the first device, then reconnect to WiFi and
repeat steps 1 and 2. The unit can only be connected to
one device at a time.
Note that any changes or modifications to the remote
enable device installed on this oven that are not
expressly approved by the manufacturer could void the
user’s authority to operate the equipment.
REMOTE STARTING YOUR OVEN
To be able to start the oven remotely once connected to
WiFi, press the Remote Enable pad and the icon will
turn on in the display. The oven can now be remotely
started with a connected device. The icon must be lit
to start the oven remotely. The icon is not required to
change the oven temperature while it is running, set a
timer or to turn the oven off from the phone app while the
icon shows it is Wifi Connected.
To disconnect your phone from Remote Enable, press
the Remote Enable pad and the icon will turn off.
NOTE: Foodsthatspoileasily—suchasmilk,eggs,fish,
stuffings,poultryandpork—shouldnotbeallowedto
sit for more than 1 hour before or after cooking. Room
temperature promotes the growth of harmful bacteria. Be
sure that the oven light is off because heat from the bulb
will speed harmful bacteria growth.
Clock
This setting sets the oven clock time. Press the Settings
pad and select Set Clock. Follow the instructions to set
the clock. This feature also specifies how the time of
day will be displayed. You can select a standard 12-hour
clock (12H), 24-hour military time display (24H), or no
clock displayed (Off). Press the Settings pad, select Set
Clock and select either 12/24 hr or On/Off.
Bluetooth®- Chef Connect
This is a pairing feature for use with other compatible
Chef Connect enabled products like an over-the-range
microwave oven or range hood. To pair those products to
the range Press the Settings pad and select Bluetooth®.
Select Pair and follow the corresponding instructions
included with the mating Chef Connect enabled product.
The range will cancel pairing mode after two minutes if
no mating device is detected. Select Remove to confirm
product is paired or to un-pair from range.
Auto Conv (Auto Conversion)
When using Convection Bake cooking, Auto Recipe
Conversion will automatically convert the regular baking
temperatures entered to convection bake cooking
temperatures when turned on. Note that this option
does not convert convection bake cooking times, it only
converts temperatures. This feature may be turned On or
Off. Select Settings and Auto Conversion, then follow
the prompts to turn this feature on or off.
Auto Off
This feature shuts the oven down after 12 hours of
continuous operation. It may be enabled or disabled. Select
Settings, More, and Auto Off to turn this feature on or off.
Sound
You can adjust the volume and type of alert your
appliance uses. Select Settings, More, and Sound.
Follow prompts for making volume adjustments or for
changing between continuous and single alert tones. A
continuous setting will continue to sound a tone until a
button on the control is pressed. The oven tone volume
can be adjusted between several settings and off. The
control will sound the oven tone at the new volume level
each time the sound level is changed.
F/C (Fahrenheit or Celsius)
The oven control is set to use Fahrenheit temperatures
(F), but you can change it to use Celsius temperatures
(C). Select Settings, More, and F/C to alter between
temperature scales displayed.
Adjust the Oven temperature
This feature allows the oven cooking modes to be
adjusted up to 35ºF hotter or down to 35ºF cooler. Use
this feature if you believe your oven temperature is too hot
or too cold and wish to change it. This adjustment affects
Bake and Convection Bake modes. No other cooking
modes are affected. Select Settings and Oven Adjust to
add More Heat or Less Heat and then press Save (for
double ovens use the Upper Oven or Lower Oven menu
selection corresponding to the oven to be adjusted).
Oven Info
To display the model number and software version on
your unit, select Settings, More, and Oven Info.
USING THE RANGE: Settings

49-2001056 Rev. 0 15
TheSabbathmodefeaturecomplieswithstandardssetforthbyStarK.Someofthesestandardsthatwillbenoticed
by the consumer include the disabling of tones, disabling of oven lights, and delays of about 30 seconds to one
minute on display changes. Only continuous baking or timed baking is allowed in the Sabbath mode. Cooking in the
Sabbath mode is a two-step process, first the Sabbath mode must be set and then the bake mode must be set.
Setting the Sabbath Mode
Press the Settings pad, select Sabbath, and select
Turn on. A single bracket “]” will appear in the display
indicating that the Sabbath mode is set. The clock will not
be displayed. Continuous bake or timed bake can now be
programmed.
Starting a Continuous Bake
1. Press the Bake pad. (For double ovens, this operates
the upper oven. If desiring to use Lower Oven, press
Lower Oven and then Bake.)
2. If the desired temperature is 350F, press Start/
Enter. If a different cooking temperature is desired,
use the 1through 5number pads to select a preset
cooking temperature, then press Start/Enter. Refer
to the graphic below to determine which pad sets the
desired cooking temperature.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking.
Adjusting the Temperature
1. Press Bake (or press Lower Oven and then Bake for
lower oven in a double oven unit), use the 1through
5number pads to select a different preset cooking
temperature, and press Start/Enter.
2. Since no feedback is given during temperature
change, an oven thermometer can be used to confirm
temperature changes.
Starting a Timed Bake
1. Press the Bake pad.
2. If the desired temperature is 350F, use the 6through
0number pads to select a cooking time. If a cooking
temperature other than 350F is desired, use the 1
through 5number pads to select a preset cooking
temperature, then select the cooking time. Refer to
the graphic on this page to determine which pad sets
the desired cooking temperature and cooking time.
3. Press Start/Enter.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking. When the cook
time expires, the display will change back to a single
bracket “]” indicating that the oven is no longer baking.
No tone will sound when the cook time is complete.
Exit the Sabbath Mode
Exiting the Sabbath mode should be done after the
Sabbath is over.
1. Press Cancel/Off to end any bake mode that may be
running.
2. Press and hold Settings pad until Sabbath Mode off
is displayed.
Sabbath Mode Power Outage Note
If a power outage occurs while the oven is in Sabbath
Mode, the unit will return to Sabbath Mode when power
is restored, however the oven will return to the off state
even if it was in the middle of a bake cycle when the
power outage occurred.
Sabbath Mode
USING THE RANGE: Sabbath Mode
Temperature (°F)
Time (hours)
200
325
2.5h
250
400
3h
4h
300
2h
3.5h
1 = 200° F, 2 = 250° F, 3 = 300° F, 4 = 325° F, 5 = 400° F
6 = 2 hours, 7 = 2.5 hours, 8 = 3 hours, 9 = 3.5 hours, 0 = 4 hours

16 49-2001056 Rev. 0
Recommended rack positions for various types of
foods are provided in the Cooking Guide. Adjusting
rack position is one way to impact cooking results. For
example, if you would prefer darker tops on cakes,
muffins, or cookies, try moving food one rack position
higher. If you find foods are too brown on top try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is at least 1½" between pans to allow
sufficient space for air to flow.
To avoid possible burns, place the racks in the desired
position before you turn the oven on.
USING THE RANGE:OvenRacks/AluminumFoilandOvenLiners/Cookware /CookingModes
Oven Racks
Cookware
Cookware Guidelines
The material, finish, and size of cookware affect baking
performance.
Dark, coated and dull pans absorb heat more readily
than light, shiny pans. Pans that absorb heat more
readily can result in a browner, crisper, and thicker crust.
If using dark and coated cookware check food earlier
than minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
oven temperature by 25ºF next time.
Shiny pans can produce more evenly cooked baked
goods such as cakes and cookies.
Glass and ceramic pans heat slowly but retain heat well.
These types of pans work well for dishes such as pies
and custards.
Air insulated pans heat slowly and can reduce bottom
browning.
Keepcookwarecleantopromoteevenheating.
CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foil may be used to catch spills by placing a sheet on a lower rack, several inches below the food. Do not use more
foilthannecessaryandneverentirelycoveranovenrackwithaluminumfoil.Keepfoilatleast1-1/2”fromovenwalls
to prevent poor heat circulation.
Aluminum Foil and Oven Liners
The number of rack positions may vary by model.
Cooking Modes
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Cooking Guide section for rack position and other recommendations for specific modes and foods.
Bake
The bake mode is for baking and roasting. When
preparing baked goods such as cakes, cookies and
pastries, always preheat the oven first. To use this
mode press the Bake pad, enter a temperature with the
number pads, and then press Start/Enter.
Warm
Warm mode is designed to keep hot foods hot. Cover
foods that need to remain moist and do not cover foods
that should be crisp. Preheating is not required. Do not
use warm to heat cold food It is recommended that food
not be kept warm for more than 2 hours. Press the Warm
pad and then press Start/Enter on single ovens; on
double ovens, press Options and then select Warm and
then follow any display prompts to access this mode.

49-2001056 Rev. 0 17
USING THE RANGE: Cooking Modes
Broiling Modes
Always broil with the oven door closed. Monitor food
closely while broiling. Use caution when broiling: placing
food close to the broil element increases smoking,
spattering and the possibility of fats igniting. It is not
necessary to preheat when using the Broil modes.
Broil Hi
The Broil Hi mode uses intense heat from the upper
element to sear foods. Use Broil Hi for thinner cuts
ofmeatand/orwhenyouwouldliketohaveaseared
surface and rare interior. To use this mode press the
Broil pad once and then press Start/Enter.
Broil Lo
The Broil Lo mode uses less intense heat from the
upper element to cook food thoroughly while also
browning the surface. Use Broil Lo for thicker cuts of
meatand/orfoodsthatyouwouldlikecookedallthe
way through. To use this mode press the Broil pad
twice and then press Start/Enter.
Frozen - Snacks
The Frozen Snacks modes are designed to cook frozen
foods such as potato nuggets, French fries, and similar
frozen snacks and appetizers. Most foods will cook
within package recommended time. Adjust cooking time
according to individual preferences.
Use Frozen Snacks Single when cooking frozen snacks
on a single rack. This mode does not require preheating
the oven. Food should be placed in the oven before or
immediately upon starting this mode.
Use Frozen Snacks Multi when cooking frozen snacks
on two racks simultaneously. This mode includes a
preheating cycle to prepare the oven for multi-rack
baking. Press Options and select Frozen then follow any
display prompts to access this mode.
Frozen - Pizza
The Frozen Pizza modes are designed to cook
frozen pizzas. Most pizzas will cook within package
recommended times. Adjust cooking time according to
individual preferences.
Use Frozen Pizza Single when cooking on a single rack.
This mode does not require preheating the oven. Food
should be placed in the oven before or immediately upon
starting this mode.
Use Frozen Pizza Multi when cooking on two racks
simultaneously. This mode includes a preheating cycle
to prepare the oven for multi-rack baking. Press Options
and select Frozen then follow any display prompts to
access this mode.
Baked Goods
The Baked Goods mode is designed for cooking cakes,
breads, cookies, and similar foods on a single rack. This
mode is designed to provide lighter top browning and
better volume. Some foods may require slightly longer
cook times relative to when cooked in the traditional bake
mode. Press Options and select Baked Goods than
follow any display prompts to access this mode.
Convection Bake
The Convection Bake mode is intended for baking
on multiple racks at the same time. This mode uses
air movement from the convection fan to enhance
cooking evenness. Your oven is equipped with Auto
Recipe Conversion, so it is not necessary to adjust the
temperature when using this mode. Always preheat
when using this mode. Baking times may be slightly
longer for multiple racks than what would be expected
for a single rack. To use this mode press the Conv Bake
pad, enter a temperature with number pads, and then
press Start/Enter.
Convection Roast
The Convection Roast mode is intended for roasting
whole cuts of meat on a single rack. This mode uses
movement from the convection fan to improve browning
and reduce cooking time. It is not necessary to convert
temperature. Check food earlier than the recipe suggested
time when using this mode, or use the probe. To use this
mode press the Conv Roast pad, enter a temperature
with the number pads, and then press Start/Enter.
Proof
Proof mode maintains a warm environment for rising
yeast-leavened dough move this to the end of the Proof
section.
If the oven is too warm, Proof mode will not operate and
the display will show "Oven too hot for Proof".
For best results, cover the dough while proofing and
check early to avoid over-proofing.
CAUTION Do not use the Proof mode for warming
food or keeping food hot. The proofing oven temperature
is not hot enough to hold foods at safe temperatures.
Pre-Heat
Proper preheating ensures that the oven is hot enough
to begin baking. Improper preheating (that is, cooking
in the oven that has not come up to set temperature)
can negatively affect cooking. Depending on the recipe
recommendations, the temperature of your foods when
they go into the oven may determine your final baking
time and baking results; if you put your food, such as
biscuits or breads, in during Pre-heat, they may over
brown on top or burn.
IMPORTANT: The more items to be heated in the oven
during preheat (this includes multiple racks, baking
stones, etc.) will affect the length of your pre-heat time.
Always begin baking after the pre-heat signal. The signal
will be a beep, indicaotr light or chime. This lets you
know your oven is at your needed baking temperature.
For best results, turn the oven On before you begin your
prep work.
Cooking Modes (Cont.)

18 49-2001056 Rev. 0
Internal food temperature is frequently used as an
indicator of doneness, especially for roasts and poultry.
The Probe mode monitors the internal food temperature
and turns the oven off when the internal food
temperature reaches the programmed temperature.
Always check the temperature at multiple locations in
the food with a food thermometer after cooking to ensure
that all portions of the food have reached the minimum
safe internal temperature for that food.
Proper Probe Placement
After preparing the meat and placing it on the cooking
pan follow these instructions for proper probe placement.
■ Inserttheprobeintothefood,sothatthetipofthe
probe will rest in the center of the thickest part of
the food. For best performance the probe should
be fully inserted into the food. If the probe is not
located properly, it may not accurately measure the
temperature of the coolest portion of the food. Some
foods, particularly small items, are not well suited for
cooking with the probe due to their shape or size.
■ Theprobeshouldnottouchbone,fatorgristle.
■ Forwholepoultryinserttheprobeintothethickest
part of the breast.
■ Forbonelessroasts,inserttheprobeintothecenter
of the roast.
■ Forbone-inhamorlamb,inserttheprobeintothe
center of the lowest large muscle or joint.
■ Forcasserolesordishessuchasmeatloaf,insertthe
probe into the center of the dish.
■ Forfish,inserttheprobefromjustabovethegillinto
the meatiest area, parallel to the backbone.
Probe Usage
The temperature probe can only be used with Bake,
Convection Bake, and Convection Roast
To use the probe with preheating:
1. Press the desired cook mode (Bake, Convection
Bake, or Convection Roast) pad and enter the
desired cooking temperature with the number pads.
2. Insert the probe into the food (see Proper Probe
Placement).
3. Once the oven is preheated, place the food in the
oven and connect the probe to the probe outlet,
making sure it is fully inserted. Use caution, the oven
walls and probe outlet are hot.
4. When the probe is connected, the display will prompt
you to enter the desired food temperature. The
maximum internal food temperature that you can set
is 200° F.
To use the probe without preheating:
1. Insert the probe into the food (see Proper Probe
Placement).
2. Place the food in the oven and connect the probe into
the probe outlet in the oven.
3. Press the Cook Mode pad (Traditional Bake,
Convection Bake, or Convection Roast) and enter
the desired cooking temperature with the number
pads. Press Options and select Probe then follow
the display prompts to enter the desired food
temperature.
Probe Care Guidelines
■ Useofprobesotherthantheoneprovidedwiththis
product may result in damage to the probe outlet.
■ Usethehandlesoftheprobeandplugwheninserting
and removing them from the meat and outlet
■ Toavoiddamagingyourprobe,donotusetongsto
pull on the cable when removing it.
■ Toavoidbreakingtheprobe,makesurefoodis
completely defrosted before inserting the probe.
■ Topreventpossibleburns,donotunplugtheprobe
from the outlet until the oven has cooled.
■ Neverleavetheprobeinsidetheovenduringaselfor
steam clean cycle.
■ Donotstoretheprobeintheoven.
Probe (Lower oven only on dual ovens)
USING THE RANGE: Probe
WARNING
Consuming undercooked food can result in foodborne illness. Use probe according to
the following instructions to ensure all portions of the food reach minimum safe cooking temperatures.
Recommendations for minimum safe food temperatures can be found at foodsafety.gov or IsItDoneYet.gov.

49-2001056 Rev. 0 19
USING THE RANGE: Cooking Guide – Single Oven
Cooking Guide – Single Oven
FOOD TYPE
RECOMMENDED
MODE(S)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer cakes, sheet cakes, bundt
cakes, muffins, quick breads on a
Single Rack
Bake
Bake Goods 3 Use shiny cookware.
Layer cakes* on Multiple Racks Bake
Convection Bake 2 and 4 Use shiny cookware. Ensure adequate airflow (see illustration below).
Chiffon cakes (angel food) Bake
Bake Goods 1 Use shiny cookware.
Cookies, biscuits, scones on a
Single Rack
Bake
Bake Goods 3 Use shiny cookware.
Cookies, biscuits, scones on
Multiple Racks Convection Bake 2 and 4
2, 4, and 6 Use shiny cookware. Ensure adequate airflow.
Yeast Breads
Proof 2 or 3 Cover dough loosely.
Bake
Bake Goods 3
Beef & Pork
Hamburgers Broil High 6
Useabroilpan;movefooddownformoredoneness/lesssearing.
Watch food closely when broiling. For best performance center food
below the broil heater.
Steaks & Chops Broil High 5 or 6
Useabroilpan;movefooddownformoredoneness/lesssearing.
Watch food closely when broiling. For best performance center food
below the broil heater.
Roasts Bake
Convection Roast 2 or 3 Use a low sided pan such as a broil pan. Preheating is not necessary.
Poultry
Whole chicken Bake
Convection Roast 2 or 3 Use a low sided pan such as a broil pan. Preheating is not necessary.
Bone-in chicken breasts, legs,
thighs
Broil Low
Bake 3
If breaded or coated in sauce avoid Broil High modes. Broil skin side
down first. Watch food closely when broiling. For best performance
when broiling, center food below the broil heater.
Boneless chicken breasts Broil Low
Bake 3
Movefooddownformoredoneness/lesssearingandupforgreater
searing/browningwhenbroiling.Forbestperformancewhenbroiling,
center food below the broil heater.
Whole turkey Bake
Convection Roast 1 Use a low sided pan such as a broil pan. Preheating is not necessary.
Turkey Breast Bake
Convection Roast 3 Use a low sided pan such as a broil pan. Preheating is not necessary.
Fish Broil Low 6(1/2inchthickorless)
5(>1/2inch)
Watch food closely when broiling. For best performance center food
below the broil heater.
Casseroles Bake 3 or 4
Frozen Convenience Foods
Pizza on a Single Rack Frozen Pizza Single 3 Place food in oven prior to starting mode.
Pizza on Multiple Racks Frozen Pizza Multi 2 and 4 Stagger pizzas left to right, do not place directly over each other.
Potato products, chicken nuggets,
appetizers on a Single Rack Frozen Snacks Single 4 or 5 Donotpreheat.Usedarkcookwareformorebrowning/crisping;
use shiny cookware for less browning.
Potato products, chicken nuggets,
appetizers on Multiple Racks Frozen Snacks Multi 2 and 4 Usedarkcookwareformorebrowning/crisping;useshinycookware
for less browning.
*When baking four cake layers at a time use racks 2
and 4. Place the pans as shown so that one pan is not
directly above another.
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov. Make sure to use a food thermometer
to take food temperatures.
Rear Placement
Front Placement

20 49-2001056 Rev. 0
FOOD TYPE
RECOMMENDED
MODE(S)
OVEN
(Upper / Lower)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer Cakes, sheet cakes,
bundt cakes, muffins, quick
breads on a Single Rack
Bake Upper
Lower
1
3Use shiny cookware.
Baked Goods Lower 3
Layer cakes* on Multiple
Racks
Bake
Convection Bake Lower 2 and 4 Use shiny cookware.
Ensure adequate airflow (see illustration below).
Chiffon cakes (angel food) Baked Goods Lower 1 Use shiny cookware.
Cookies, biscuits, scones
on a Single Rack
Bake Upper
Lower
1
3Use shiny cookware.
Baked Goods Lower 3
Cookies, biscuits, scones
on Multiple Racks Convection Bake Lower 2 and 4 Use shiny cookware. Ensure adequate airflow.
Yeast Breads
Proof Upper
Lower
1
3Cover dough loosely
Bake Upper
Lower
1
3
Baked Goods Lower 3
Beef & Pork
Hamburgers Broil High Lower 6
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling. For best
performance center food below the broil heating element
Steaks & Chops Broil High Lower 5 or 6
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling. For best
performance center food below the broil heating element
Roasts Bake
Convection Roast Lower 2 or 3 Use a low sided pan such as a broil pan. Preheating is
not necessary
Poultry
Whole chicken Bake
Convection Roast Lower 2 or 3 Use a low sided pan such as a broil pan.
Bone-in chicken breasts,
legs, thighs
Broil Low
Bake
Upper
Lower
1
3
If breaded or coated in sauce avoid Broil Hi modes. Broil
skin side down first. Watch food closely when broiling.
For best performance when broiling, center food below
the broil heating element.
Boneless chicken breasts Broil Low
Bake
Upper
Lower
1
3
If breaded or coated in sauce avoid Broil Hi modes. Broil
skin side down first. Watch food closely when broiling.
For best performance when broiling, center food below
the broil heating element
Whole turkey Bake
Convection Roast Lower 1 Use a low sided pan such as a broil pan.
Turkey Breast Bake
Convection Roast Lower 2 or 3 Use a low sided pan such as a broil pan.
Fish Broil Low Lower 6(1/2thickorless)
5(>1/2inch)
Watch food closely when broiling. For best performance
center food below the broil heating element.
Casseroles Bake Upper
Lower
1
3 or 4
Frozen Convenience Foods
Pizza on a single rack Frozen Pizza Single Lower 3 Do not preheat.
Pizza on multiple racks Frozen Pizza Multi Lower 2 and 4 Stagger pizzas left to right, do not place directly over
each other
Potato products, chicken
nuggets, appetizers on a
single rack
Frozen Snacks Single Upper
Lower
1
4
Donotpreheat.Usedarkcookwareformorebrowning/
crisping; use shiny cookware for less browning.
Potato products, chicken
nuggets, appetizers on
multiple racks
Frozen Snacks Multi Lower 2 and 4 Usedarkcookwareformorebrowning/crisping;use
shiny cookware for less browning.
USING THE RANGE: Cooking Guide – Double Oven
Cooking Guide – Double Oven
*When baking four cake layers at a time, use racks 2
and 4.
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov. Use a food thermometer to take food
temperatures.
Rear Placement
Front Placement
Baking four cake layers at a time
This manual suits for next models
1
Table of contents
Other Cafe Cooktop manuals
Popular Cooktop manuals by other brands

Frigidaire
Frigidaire FGC3X4XA Factory parts catalog

Frigidaire
Frigidaire FEFL77ASF Wiring diagram

GE
GE JP3030TJ Dimensions and installation information

KitchenAid
KitchenAid KGCP462KSS - 36" Gas Cooktop parts list

Fisher & Paykel
Fisher & Paykel CG365D Series Installation instructions and user guide

Parmco
Parmco HX-1-6NF-CER Installation and operating instructions