Comfortaire BHD-301-J User manual

www.marsdelivers.com
Owner’s Manual
Dehumidiers
without Pumps
BHD-301-J
BHD-501-J
BHD-701-J

Owner’s Manual - Dehumidier without Pump
2
Contents:
Preparation....................................3
Safety Precautions........................5
Cautions........................................7
Operation......................................9
Maintenance................................13
Fault Diagnosis............................14

Owner’s Manual - Dehumidier without Pump
3
Preparation
rear
front
handle
(both sides)
control panel
air intake grille
air filter (behind
the grille)
water bucket
power cord
power plug
air outlet grille
power cord band
drain hose outlet

Owner’s Manual - Dehumidier without Pump
4
Preparation
NOTE: The unit you purchased may look like one of the followings:
-Fluorinated greenhouse gases are contained in
hermetically sealed equipment. For specific
information on the type, the amount and the CO2
equivalent in tonnes of the fluorinated greenhouse
gas(on some models), please refer to the relevant
label on the unit itself.
-Installation, service, maintenance and repair of this
unit must be performed by a certified technician.
-Product uninstallation and recycling must be
performed by a certified technician.
NOTE:
All the illustrations in the manual are for explanation
purposesonly. Your machine may be slightly
different. The actual shape shall prevail. The design
and specifications are subject to change without prior
notice for product improvement. Consult with the
sales agency or manufacturer for details. Any
updates to the manual will be uploaded to the service
website, please check for the latest version.

Owner’s Manual - Dehumidier without Pump
5
-Do not exceed the rating of the
power outlet or connection device.
-Do not operate or stop this unit by
switching on or off the power supply.
-Do not damage or use an unspecified
power cord.
-Do not modify power cord length or
share the outlet with other
appliances.
-Do not insert or pull out plug with wet
hands.
-Do not install this appliance in a
location that may be exposed to
combustible gas.
-Do not place this unit near a heat
source.
-Disconnect the power if strange
sounds, smell, or smoke comes from
it.
-You should never try to take apart or
repair this unit by yourself.
This symbol indicates that ignoring instructions may cause death or
serious injury.
WARNING: To prevent death or injury to the user or other people
and property damage, the following instructions must be followed.
Incorrect operation due to ignoring of instructions may cause damage
injury or death.
Safety Precautions
-Before cleaning, turn off the power
and unplug the unit.
-Do not use this machine near
flammable gas or combustibles, such
as gasoline, benzene, thinner, etc.
-Do not drink or use the water drained
from this unit.
-Do not take the water bucket out
during operation.
-Do not use this unit in small spaces.
-Do not put in places where water may
splash onto the unit.
-Place this unit on a level, sturdy
section of the floor.
-Do not cover the intake or exhaust
openings with cloths or towels.
-Care should be taken when using this
unit in a room with the following
persons: infants, children, elderly
people, or people sensitive to
humidity.

Owner’s Manual - Dehumidier without Pump
6
WARNING: To prevent death or injury to the user or other people and
property damage, the following instructions must be followed.
Incorrect operation due to ignoring of instructions may cause
damage, injury or death.
-The manufacture nameplate is
located on the rear panel of the unit
and contains electrical and other
technical data specific to this unit.
-Be sure the unit is properly
grounded. To minimize shock and
fire hazards, proper grounding is
important. The power cord is
equipped with a three-prong
grounding plug for protection
against shock hazards.
-Your unit must be used in a
properly grounded wall receptacle.
If the wall receptacle you intend to
use is not adequately grounded or
protected by a time delay fuse or
circuit breaker(please refer to the
nameplate for the electrical data),
have a qualified electrician install
the proper receptacle.
-To avoid the possibility of personal
injury, always disconnect the power
supply to the unit, before installing
and/or servicing.
-All wiring must be performed strictly
in accordance with the wiring
diagram located on the middle
baffle of the unit (behind of the
water bucket).
Electrical Information:
-Do not use in areas where chemicals
are handled.
-Never insert your finger or other
foreign objects into grills or openings.
Take special care to warn children of
these dangers.
-Do not place heavy objectson the
power cord and take care so that the
cord is not compressed or pinched.
-Do not climb on or sit on the unit.
-Always insert the filters securely.
Clean filter once every two weeks.
-If water enters the unit, turn the unit
off and disconnect the power, and
contact a qualified service technician.
-Do not place flower vases or other
water containers on top of the unit.
-Do not use extension cords.
Safety Precautions

Owner’s Manual - Dehumidier without Pump
7
Cautions
Cautions
-This appliance can be used by children aged from 8 years and above
and personswith reduced physical, sensory or mental capabilities if they
have been given supervision or instruction concerning use of the
appliance in a safe way and understand the hazards involved. Children
shall not play with the appliance. Cleaning and user maintenance shall
not be made by children without supervision.
-If the supply cord is damaged, it must be replaced by the
manufacturer,its service agent or similarly qualified persons in order to
avoid a hazard.
-Prior to cleaning or other maintenance, the appliance must be
disconnected from the power supply.
-Do not install the appliance in a location that may be exposed to
combustible gas. If combustible gas accumulates around the unit, it may
cause fire.

Owner’s Manual - Dehumidier without Pump
8
-If the appliance is knocked over during use, turn off the unit and unplug it
from the main power supply immediately. Visually inspect the unit to ensure
there is no damage. If you suspect the unit has been damaged, contact a
technician or customer service for assistance.
-In a thunderstorm, the power must be cut off to avoid damage to the machine
due to lightning.
-Do not run cord under carpeting. Do not cover cord with throw rugs, runners,
or similar coverings. Do not route cord under furniture or appliances. Arrange
cord away from traffic area and where it will not be tripped over.
-Do not operate unit with a damaged cord or plug. Discard unit or return to an
authorized service facility for examination and/or repair.
-To reduce the risk of fire or electric shock, do not use this unit with any solid-
state speed control device.
-This appliance shall be installed in accordance with national wiring
regulations.
-Contact an authorized service technician for repair or maintenance of this
unit.
-Turn off the product when not in use.
-The units circuit board (PCB) is designed with a fuse to provide overcurrent
protection. The specifications of the fuse are printed on the circuit board, such
as: T 3.15A/250V (or 350V), etc.
Cautions
Cautions

Owner’s Manual - Dehumidier without Pump
9
Operation
Place in a suitable environment
-This unit is designed to operate with a working
environment between 5OC/41OF and 32OC/90OF, and
between 30%(RH) and 80%(RH).
more than 40cm
more than 20cm
more than 20cm
more than 40cm
more than 20cm
Casters(Installed at four points on the bottom of unit)
-
Do not force casters to move over carpet, nor
move the unit with water in the bucket.
(The unit may tip over and spill water.)
NOTE: Casters are optional, some models without.
Smart functions:
-Auto Shut Off
When the bucket full indicator light illuminates or the humidity setting is
reached, the unit will shut off automatically.
-Wait 3 minutes before resuming operation
After the unit has stopped, it can not restart operation for 3 minutes.
This is to protect the unit. Operation will automatically start after 3
minutes.
-Auto Defrost
When frost builds up on the evaporator coils, the compressor will cycle
off and the fan will continue to run until the frost disappears.
-Auto-Restart
If the unit shuts off unexpectedly due to power loss, it will restart with
the previous function setting automatically when the power resumes.

Owner’s Manual - Dehumidier without Pump
10
Filter
Mode
Fan
Timer
Filter
Full
Cont. On Off
Turbo
Auto defrost
The indicator light illuminates when the function is
selected.
Down/Up buttons
Humidity Set Control Buttons
The humidity level can be set within a range of 35%RH(Relative
Humidity) to 85%RH(Relative Humidity) in 5% increments.
For drier air, press the Down button and set to a lower percent value(%).
For damper air, press the Up button and set a higher percent value(%).
Timer Set Control Buttons
Press to initiate the Auto start and Auto stop feature,
in conjuction with the Up and Down buttons.
Filter button
The check filter feature is a reminder to clean the
Air Filter for more efficient operation. The Filter
light(Clean filter light) will flash after 250 hours of
operation. To reset after cleaning the filter, press
the Filter button and the light will go off.
Mode button
Press to select the desired operation mode from
Dehumidifying,Continuous dehumidifying and Comfort
dehumidifying.
At Comfort dehumidifying mode, the unit will automatically
control room humidity in a comfortable range 45%~55%
according to the room temperature. The humidity setting function
will be invalid.
Filter
Mode
Operation
NOTE: The control panel may look like one of the following:
Comfort

Owner’s Manual - Dehumidier without Pump
11
Operation
Indicator lights
Filter
On
Comfort
Auto defrost
Filter light Bucket full light
Continuous dehumidifying light
Timer on light
Timer off light
High fan light
Comfort dehumidifying light
Auto defrost light
Timer button
Press to initiate the Auto start and Auto stop feature, in conjunction
with the UP and Down buttons.
When the unit is on, first press the Timer button, the Timer Off
indicator light illuminates. It indicates the Auto Stop program is
initiated. Press again and the Time On indicator light illuminates. It
indicates the Auto Start is initiated.
When the unit is off, first press the Timer button, the TIMER ON
indicator light illuminates. It indicates the Auto Start program is
initiated. Press it again and the Time Off indicator light illuminates. It
indicates the Auto Stop is initiated.
Press or hold the UP or Down button to change the Auto time by 0.5
hour increments, up to 10 hours, then at 1 hour increments up to 24
hours. The control will count down the time remaining until start.
The selected time will register in 5 seconds and the system will
automatically revert back to display the previous humidity setting.
When the Auto start & Auto stop times are set within the same
program sequence, TIMER ON OFF indicator lights illuminate
identifying both ON and OFF times are now programmed.
Turning the unit ON or OFF at any time or adjusting the timer setting
to 0.0 will cancel the Auto Start/Stop function.
When LED display window displays the code of P2, the Auto Start/
Stop function will also be canceled.
Fan button
Controlsthe fan speed. Press to select either High or Normal fan
speed. Set the fan control to High for maximum moisture removal.
When the humidity has been reduced and quiet operation is
preferred, set the fan control to Normal.
Power button
Press to turn the dehumidifier on and off.
Timer
Fan
Power
Cont.
Off
Turbo
Full

Owner’s Manual - Dehumidier without Pump
12
LED display
Shows the set % humidity level from 35% to 85% or auto start/
stop time (0~24) while setting, then shows the actual (±5%
accuracy) room % humidity level in a range of 30%RH(Relative
Humidity) to 90%RH(Relative Humidity).
Error Codes:
AS- Humidity sensor error.
ES- Temperature sensor error.
Protection Codes:
P2- Bucket is full or not in right position-- Empty the bucket and
replace the bucket in the right position.
Note: When one of the above malfunctions occurs, turn off the
unit, and check for any obstructions. Restart the unit, if the
malfunction is still present, turn off the unit and unplug the
power cord. Contact the manufacturer,its service agents or a
similar qualified person for service.
Removing the collected water
There are two ways to remove collected water:
1.Use the bucket
When the bucket is full, remove the bucket and empty it.
water outlet
2.Continuous draining
Water can be automatically emptied into a floor drain by attaching the unit
with a water hose (Id≥Φ 5/16",not included) with a female threaded end
(ID:M=1" , not included).
-Drain hose subassembly: Install the drain hose onto the adaptor A (placed in
the bucket).
Drain hose AdaptorA
Operation
-Remove the plastic cover from the back drain outlet of the unit, set aside and
remove bucket, then insert the drain hose through the drain outlet of the unit and
securely press it into the connector on the front of the unit. Tighten the adapter A
and the unit by using two screws (placed in the bucket).

Owner’s Manual - Dehumidier without Pump
13
-Install the female threaded end of the water hose into the adaptor A, then lead
the water hose to the floor drain or a suitable drainage point.
NOTE:
-
-
Make sure the connection is tight and there is no leak.
Lead the water hose to the floor drain or a suitable
drainage facility, the drainage facility should be lower
than the drain outlet of the unit.
-Be sure to run the water hose sloping downward to let
the water flow out smoothly.
-When the continuous drain feature is not being used,
remove the drain hose from the outlet.
Drain hose
subassembly
Connector
Drain hose
Plastic cover
Water hose
Female
threaded
end
Band
CAUTION: DO NOT
operate the dehumidifier
without a filter because
dirt and lint will clog it
and reduce performance.
or
Maintenance
Care and cleaning of the dehumidifier
WARNING: Turn the dehumidifier off and remove the plug from the wall outlet
before cleaning.
1.Clean the bucket.Clean the bucket with water every few weeks.
2.Clean the air filter. Clean the filter with water at least every 30 days or more
often if necessary.
3.Store the unit
Power cord
-After turning off the unit, wait one day before emptying the bucket.
-Clean the main unit, bucket and air filter.
-Wrap the cord and bundle it with the band.
-Cover the unit with a plastic bag.
-Store the unit upright in a dry, well-ventilated place.
Operation
When not using the unit for long time periods
It is advised to run drain hose no farther than 6ft. with no rises or traps.

Owner’s Manual - Dehumidier without Pump
14
Faults Diagnosis
Unit does not start
Water on floor
Frost appears on the coils
The unit makes a loud
noise when operating
Dehumidifier does not
dry the air as it should
-Make sure the dehumidifiers plug is pushed
completely into the outlet.
-Check the house fuse/circuit breaker box.
-Dehumidifier has reached its preset level or
bucket is full.
-Bucket is not in the proper position.
-The air filter is clogged.
-The unit is tilted instead of upright as it should be.
-The floor surface is not level.
-Hose to connector or hose connection may be
loose.
-Intend to use the bucket to collect water, but the
back drain plug is removed.
-This is normal. The unit has Auto defrost feature.
-
-Did not allow enough time to remove the moisture.
Make sure there are no curtains, blinds or furniture
blocking the front or back of the dehumidifier.
-The humidity selector may not be set low enough.
-Check that all doors, windows and other openings
are securely closed.
-Room temperature is too low, below 5°C(41°F).
-There is a kerosene heater or something giving off
water vapor in the room.
Please check the machine according to the following form before asking for
maintenance:
Faults Diagnosis What to check
Please request for repair if unit operatesabnormally or does not operate,
and the solutions above do not resolve the problem.

CW064IU-SCFN8
16120300000399
Congratulations on purchasing your new HVAC equipment. It’s
been designed for long life and reliable service, and is backed
by one of the strongest warranties in the industry. Your unit
automatically qualifies for the warranty coverage listed below,
providing you keep your proof of purchase (receipt) for the
equipment and meet the warranty conditions.
LIMITED ONE (1) YEAR EXPRESS WARRANTY
Comfort-Aire warrants this Room Air Conditioner to be free from
defects in workmanship and materials for normal use and
maintenance for one (1) year from the date of purchase by the
original consumer. This Express Limited Warranty applies only when
the Room Air Conditioner is installed and operated per Comfort-Aire
installation and operating instructions for normal use.
EXCEPTIONS
The Limited Express Warranty does not cover normal maintenance
Comfort-Aire recommends that regular inspection/maintenance be
performed at least once a season. Additionally, labor charges
diagnostic charges, transportation charges for replacement of
refrigerant or filters, and any other service calls/repairs are not covered
by this Limited Warranty. It also does not cover any portion or
component of the system that is not supplied by Comfort-Aire,
regardless of the cause of failure of such portion or component.
CONDITIONS FOR WARRANTY COVERAGE
Unit must be operated according to Comfort-Aire operating
instructions included with the unit and cannot have been subjected
to accident, alteration, improper repair, neglect or misuse, or an act
of God (such as a flood)
•Serial numbers and/or rating plate have not been altered or
removed
•
•
Performance cannot be impaired by use of any product not
authorized by Comfort-Aire, or by any adjustments or adaptations
to components
Damage has not been a result of inadequate wiring or voltage
conditions, use during brown-out conditions, or circuit interruptions
•Air flow around any section of the unit has not been restricted
•Unit remains in the original installation
DURATION OF WARRANTY & REGISTRATION
The warranty begins on the date of purchase by the original
consumer. The consumer must retain a receipted bill of sale as proof
of warranty period. Without this proof, the express warranty begins on
the date of shipment from the factory.
REMEDY PROVIDED BY THE LIMITED EXPRESS WARRANTY
The sole remedy under the Limited Warranty is replacement of the
defective unit. Labor to diagnose and replace the defective unit is
not covered by this Limited Express Warranty. If for any reason
the replacement product is no longer available during the warranty
period, Comfort-Aire shall have the right to allow a credit in the
amount of the current suggested retail price of the product instead
of providing replacement.
LIMITATION OF LIABILITY
1. There are no other express or implied warranties. Comfort-Aire
makes no warranty of merchantability. We do not warrant that the
unit is suitable for any particular purpose or can be
used in buildings or rooms of any particular size or condition
except as specifically provided in this document. There are no
other warranties, express or implied, which extend beyond the
description in this document.
2. All warranties implied by law are limited in duration to the one-term
of the warranty. We will not be liable for any consequential or
incidental damages caused by any defect in this unit.
3. This warranty gives you specific legal rights and you may also have
other rights which vary from state to state. Some states do not allow
limitation on how long an implied warranty lasts or do not allow the
exclusion or limitation of incidental or consequential damages, so
the above limitations or exclusions may not apply to you.
4. No warranties are made for units sold outside the continental
United States and Canada. Your distributor or final seller may
provide a warranty on units sold outside these areas.
5. Comfort-Aire will not be liable for damages if our performance
regarding warranty resolution is delayed by events beyond our
control including accident, alteration, abuse, war, government
restrictions, strikes, fire, flood, or other acts of God.
HOW TO SUBMIT A WARRANTY CLAIM
If you have a warranty claim, notify you installer or dealer promptly.
KEEP THIS INFORMATION AS A RECORD OF YOUR PURCHASE
PRODUCT IDENTIFICATION INSTALLATION
Model Number Installer Name (if used)
Serial Number Phone Number/Contact Information
Date of Purchase Date Installation Completed
Remember to retain your bill of sale as proof of warranty period.
LIMITED EXPRESS WARRANTY
Comfort-Aire_9-2018
Please visit
www.marsdelivers.com
to register your new product

:HOOZRUWK$YH-DFNVRQ0,3KZZZKHDWFRQWUROOHUFRP
'XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH
VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV'HWHUPLQLQJWKH
DSSOLFDWLRQDQGVXLWDELOLW\IRUXVHRIDQ\SURGXFWLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU
$GGLWLRQDOO\WKHLQVWDOOHULVUHVSRQVLEOHIRUYHULI\LQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW
SULRUWREHJLQQLQJDQ\LQVWDOODWLRQSUHSDUDWLRQV
,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH
DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH
KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULO\JUDQWHGIRUWKHOLIHRIDSURGXFW
7KHUHIRUHLWLVWKHUHVSRQVLELOLW\RIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF
PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV
09/2019
ZZZPDUVGHOLYHUVFRP
1900 Wellworth Ave., Jackson, MI 49203 • Ph. 517-787-2100 • www.marsdelivers.com
This manual suits for next models
2
Table of contents
Other Comfortaire Dehumidifier manuals

Comfortaire
Comfortaire DH600K0 User manual

Comfortaire
Comfortaire DH400K0 User manual

Comfortaire
Comfortaire R-410A User manual

Comfortaire
Comfortaire BHD-22B User manual

Comfortaire
Comfortaire BHDP-951-H Series User manual

Comfortaire
Comfortaire DH40J0 User manual

Comfortaire
Comfortaire DH25J2 User manual

Comfortaire
Comfortaire 23-11-2243N-003 User manual

Comfortaire
Comfortaire BHDP-701-J User manual