Comfortaire BHDP-951-H Series User manual

AITONS • 35 Brownridge Road, Unit 6, Halton Hills, ON L7G 0C6 • 1-888-744-2911 • www.aitons.com
Owner’s Manual
Portable Dehumidier:
BHDP-951-H Series
R-401A

Owner’s Manual BHDP-951-H Portable Dehumidier AITONS EQUIPMENT
1
SOCIABLE REMARK
DISPOSAL: Do not dispose this product as unsorted municipal waste. Collection
of such waste separately for special treatment is necessary.
It is prohibited to dispose of this appliance in domestic household waste.
For disposal, there are several possibilities:
A) The municipality has established collection systems, where electronic waste can
be disposed of at least free of charge to the user.
B) When buying a new product, the retailer will take back the old product at least
free of charge.
C) The manufacture will take back the old appliance for disposal at least free of
charge to the user.
D) As old products contain valuable resources, they can be sold to scrap metal
dealers.
Wild disposal of waste in forests and landscapes endangers your health when
hazardous substances leak into the ground-water and find their way into the food
chain.
When using this dehumidifier in the European countries, the following information
must be followed:
CONTENTS
SAFETY PRECAUTIONS
Warning ..........................................................................................................................................2
Caution ...........................................................................................................................................2
Electrical information ......................................................................................................................3
OPERATING THE UNIT
When using the unit .......................................................................................................................7
Removing the collected water ........................................................................................................8
CARE AND MAINTENANCE
Care and cleaning of the dehumidifier ...........................................................................................9
TROUBLESHOOTING TIPS
Troubleshooting tips .....................................................................................................................10
CONTROL PADS ON THE DEHUMIDIFIER
Control pads....................................................................................................................................4
Other features................................................................................................................. ...............5
IDENTIFICATION OF PARTS
Identification of parts ......................................................................................................................6
Positioning the unit .........................................................................................................................7
SAFETY PRECAUTIONS
Warning .........................................................................................................................2
Caution ..........................................................................................................................2
Electrical Information.....................................................................................................3
CONTROL PADS ON THE DEHUMIDIFIER
Control panel .................................................................................................................4
Other features................................................................................................................5
IDENTIFICATION OF PARTS
Identication of parts .....................................................................................................6
Positioning the unit ........................................................................................................7
OPERATING THE UNIT
When using the unit.......................................................................................................7
Removing the collected water .......................................................................................8
CARE AND MAINTENANCE
Care and cleaning of the dehumidier.........................................................................10
TROUBLESHOOTING TIPS
Troubleshooting Tips ................................................................................................... 11
Read This Manual
Inside you will nd many helpful hints on how to use and maintain your air conditioner properly. Just a little preventive care
on your part can save you a great deal of time and money over the life of your air conditioner. You’ll nd many answers to
common problems in the chart of troubleshooting tips. If you review our chart of Troubleshooting Tips rst, you may not
need to call for service at all.
CAUTION
• This appliance can be used by children aged from 8 years and above and persons with reduced physical, sensory or
mental capabilities or lack of experience and knowledge if they have been given supervision or instruction concerning
use of the appliance in a safe way and understand the hazards involved. Children shall not play the appliance.
Cleaning and user maintenance shall not be done by children without supervision. (applicable for the European
Countries)
• This appliance is not intended for use by persons (including children) with reduced physical, sensory or mental
capabilities or lack of experience and knowledge, unless they have been given supervision or instruction concerning
use of the appliance by a person responsible for their safety. (applicable for other countries except the European
Countries)
• Children should be supervised to ensure that they do not play with the appliance.
• If the supply cord is damaged, it must be replaced by the manufacturer, its service agent or similarly qualied persons
in order to avoid a hazard.
• The appliance shall be installed in accordance with national wiring regulations.
• The appliance with electric heater shall have at least 1 meter space to the combustible materials.
• Contact the authorized service technician for repair or maintenance of this unit.

BHDP-951-H Portable Dehumidier Owner’s Manual
2
• Lack of ventilation can cause
overheating and re.
Do not use the unit in small
spaces.
CAUTION
!
• If the unit falls over, it may
cause water to spill and
damage belongings, or cause
electrical shock or re.
Place the unit on a level,
sturdy section of the oor.
• Water may enter the unit and
degrade the insulation. It may
cause an electric shock or re.
Do not put in places where
water may splash onto the
unit.
• Otherwise, it may cause
electric shock or re due to
excess heat generation.
Do not exceed the rating
of the power outlet or
connection device.
WARNING
!
• It may cause electric shock
or re.
Do not damage or use an
unspecied power cord.
• It may cause electric shock
or re due to heat generation.
Do not operate or stop the
unit by switching on or off
the power.
• It may cause electric shock
or re due to heat generation.
Do not modify power cord
length or share the outlet
with other appliances.
• Plastic parts may melt and
cause a re.
Do not place the unit near
a heat source.
• It may cause electric shock.
Do not insert or pull out
plug with wet hands.
• It may cause re and electric
shock.
Disconnect the power if
strange sounds, smell, or
smoke comes from it.
• It may cause electrical shock
or injury.
Before cleaning, turn off
the power and unplug the
unit.
• It may cause failure of
machine or electric shock.
You should never try to
take apart or repair the unit
by yourself.
• It may cause an explosion or
re.
Do not use the machine near
ammable gas or combustibles,
such as gasoline, benzene,
thinner, etc.
• It may trigger bucket full
safety of the unit and cause
electric shock.
Do not take the water
bucket out during
operation.
• It contains contaminants and
could make you sick.
Do not drink or use the
water drained from the
unit.
To prevent injury to the user or other people and property damage, the following instructions must be
followed. Incorrect operation due to ignoring of instructions may cause harm or damage.
n The seriousness is classied by the following indications.
nMeanings of symbols used in this manual are as shown below.
saFeTY PreCauTIOns
!
!This symbol indicates the possibility of injury or damage to property.CAUTION
This symbol indicates the possibility of death or serious injury.WARNNG
Always do this.
Never do this.
!
!
!
!
AITONS EQUIPMENT

Owner’s Manual BHDP-951-H Portable Dehumidier
3
• A lack of airow can lead to
overheating and re.
Do not cover the intake
or exhaust openings with
cloths or towels.
CAUTION
!
• This will cause unit deterioration
due to chemicals and
solvents dissolved in the air
Do not use in areas where
chemicals are handled.
• Infants, children, elderly
people and people not
sensitive to humidity.
Care should be taken when
using the unit in a room
with the following persons.
• It may cause electric shock
or failure of appliance.
Never insert your nger
or other foreign objects
into grills or openings.
Take special care to warn
children of these dangers.
• You may be injured if you fall
or if the unit falls over.
Do not climb up on or sit on
the unit.
• There is danger of re or
electric shock.
Do not place heavy object
on the power cord and take
care so that the cord is not
compressed.
• Operation without lters may
cause failure.
Always insert the lters
securely. Clean lter once
every two weeks.
• Water may spill inside the
unit, causing insulation failure
and electrical shock or re.
Do not place ower vases
or other water containers
on top of the unit.
• It may cause failure of
appliance or accident.
If water enters the unit, turn
the unit off and disconnect
the power, contact a qual-
ied service technician.
• It may cause damage to
appliance or injure your
nger.
Be careful when removing the
lter not to damage the ns.
• It may cause failure of
appliance.
Turn off the unit before
removing the water bucket.
saFeTY PreCauTIOns
Electrical Information
• The manufactures nameplate is located on the rear panel of the unit and contains electrical and other
technical data specic to this unit.
• Be sure the unit is properly grounded. To minimize shock and re hazards, proper grounding is
important. The power cord is equipped with a three-prong grounding plug for protection against shock
hazards.
• Your unit must be used in a properly grounded wall receptacle. If the wall receptacle you intend to use is
not adequately grounded or protected by a time delay fuse or circuit breaker, have a qualied electrician
install the proper receptacle.
• Ensure the receptacle is accessible after the unit installation.
•Do not use extension cords or adapter plugs with this unit. However, if it is necessary to use an
extension cord, use an approved Dehumidier extension cord only (available at most local hardware
stores).
• To avoid the possibility of personal injury, always disconnect the power supply to the unit, before
installing and/or servicing.
!
!!
!
!
AITONS EQUIPMENT

BHDP-951-H Portable Dehumidier Owner’s Manual
4
COnTrOl PaDs On THe DeHuMIDIFIer
NOTE: The control panel of the unit you purchased may be lightly different according to the models.
Control pads
When you push the button to change operation modes, the
unit will make a beep sound to indicate that it is changing
modes.
1 PUMP Pad(on some models)
Press to activate the pump operation.
NOTE: Make sure the pump drain hose is installed
into the unit and the continuous drain hose is removed from
the unit before the pump operation is activated. When the
bucket is full,the pump starts to work. Refer to the next
pages for removing the collected water.
Do not use this operation when the outdoor temperature
is equal to or less than 0°C (32°F).
COMFORT Pad(optional)
Press to activate the comfort dehumidifying operation.
NOTE: On this operation,the unit can not set humidity level.
FILTER Pad
The check lter feature is a reminder to clean the Air Filter
for more efcient operation. The Filter light (Clean lter light)
will illuminate after 250 hours of operation. To reset after
cleaning the lter, press the Filter pad and the light will go off.
TURBO Pad
Controls the fan speed. Press to select either High
or Normal fan speed. Set the fan control to High for
maximum moisture removal. When the humidity has been
reduced and quiet operation is preferred, set the fan control
to Normal.
ION Pad(optional)
Press to activate the ionizer. Ions are automatically
generated by ionization. The ions deactivate the airborne
chemical vapors and dust particles. Press
again to stop the function.
POWER Pad
Press to turn the dehumidier on and off
: Down/Up Pads
• Humidity Set Control Pads
The humidity level can be set within a range of
35%RH(Relative Humidity) to 85%RH(Relative
Humidity) in 5% increments.
For drier air, press the pad and set to a lower
percent value(%).
For damper air, press the pad and set a higher
percent value(%).
• TIMER Set Control Pads
Use the Up/Down pads to set the Auto
start and Auto stop time from 0.0 to 24.
TIMER Pad
Press to initiate the Auto start and Auto stop feature,
in conjunction with the and pads.
CONTINUE Pad
Press to activate the continuous dehumidifying operation.
DISPLAY
Shows the set % humidity level from 35% to 85% or auto
start/stop time (0~24) while setting, then shows the actual
(+ 5% accuracy) room % humidity level in a range of 30%
RH (Relative Humidity) to 90%RH (Relative Humidity).
Error Codes and Protection Code:
AS- Humidity sensor error--Unplug the unit and plug it back
in. If error repeats, call for service.
2
1
3
4
5
6
+
-
9
10
11
+-
Fig. 1
Timer on/off indicator light Auto defrost operation
on indicator light
Pump operation on indicator light
Continuous operation on indicator light
Comfort dehumidifying operation on indicator light
Clean lter
indicator
light
Ion operation indicator light
High fan indicator light
Bucket full
indicator light
POWER
PUMP COMFOFT TURBO IONFILTER
POWERTIMERCONT.
On
Off
FullDefrost
87 - +
AITONS EQUIPMENT

Owner’s Manual BHDP-951-H Portable Dehumidier
5
ES- Temperature sensor error-- Unplug the unit and
plug it back in. If error repeats, call for service.
P2- Bucket is full--or bucket is not in right position--
Empty the bucket and replace it in the right position.
EC- Unit malfunction--Please make sure the ambient
temperature is within the temperature range stated in
the manual. If not, please operate the unit under the
stated temperature. If the environment temperature
is suitable for the stated temperature, please call for
service.
E3 Unit malfunction-- Unplug the unit and plug it
back in. If error repeats, call for service.
Eb- The bucket has been removed from the unit or
is not in the right position. Replace or reposition the
bucket properly.
OTHer FeaTures
Bucket Full Light
Glows when the bucket is ready to be emptied.
Auto Shut Off
The dehumidier shuts off after 30 seconds when the
bucket is full, or when the bucket is removed or not
seated in the proper position. When the set humidity is
reached, the unit will shut off automatically. For some
models, the fan motor will continue operating.
Auto Defrost
When frost builds up on the evaporator coils, the
compressor will cycle off and the fan will continue to run
until the frost disappears.
Wait 3 minutes before resuming operation
After the unit has stopped, it can not be restarted for
3 minutes. This is to protect the unit. Operation will
automatically occur after 3 minutes.
Check Filter Feature
The system starts to count the time once the fan motor
operates. The check lter feature can be only activated
when the accumulated operation time achieves 250
hours or more. The Reset light (Clean lter indicator light)
ashes one time per second. After cleaning the air lter,
press the Filter pad, to turn the lter light (clean lter
indicator light) off. The time resets.
Auto Restart
If the unit shuts off unexpectedly due to the power cut, it
will restart with the previous function setting automatically
when the power resumes.
Setting the Timer
• When the unit is on, rst press the Timer button, the
Timer Off indicator light illuminates. It indicates the
Auto Stop program is initiated. Press it again the Time
On indicator light illuminates. It indicates the Auto Start
is initiated.
• When the unit is off, rst press the Timer button, the
TIMER ON indicator light illuminates. It indicates the
Auto Start program is initiated. Press it again the and
Time Off indicator light illuminates. It indicates the Auto
Stop is initiated.
• Press or hold the UP or DOWN pad to change the Auto
time by 0.5 hour increments, up to 10 hours, then at 1
hour increments up to 24 hours. The control will count
down the time remaining until start.
• The selected time will register in 5 seconds and the
system will automatically revert back to display the
previous humidity setting.
• When the Auto start & Auto stop times are set within
the same program sequence, TIMER ON OFF
indicator lights illuminate identifying both ON and OFF
times are now programmed.
• Turning the unit ON or OFF at any time or adjusting
the timer setting to 0.0 will cancel the Auto Start/Stop
function.
• When LED display window displays code P2, the Auto
Start/Stop function will also be cancelled.
AITONS EQUIPMENT

BHDP-951-H Portable Dehumidier Owner’s Manual
6
Identication of Parts
Front
Control panel
Air outlet grille
Water bucket
Handle (both sides)
Rear
Continuous drain hose outlet
Caster
Power cord and plug
Pump drain hose outlet (some models without)
Band (used only when storing the unit)
Air intake lter
NOTE: All the pictures in the manual are for explanation purposes only. The actual shape of the
unit you purchased may be slightly different, but the operations and functions are the same.
IDenTIFICaTIOn OF ParTs
1
3
2
4
1
3
2
4
5
aCCessOrIes
pump drain hose (1 pc) (only for the unit
with pump feature)
Fig. 2
Fig. 3
6
AITONS EQUIPMENT

Owner’s Manual BHDP-951-H Portable Dehumidier
7
OPeraTInG THe unIT
Positioning the Unit
A dehumidier operating in a basement will have little or no effect
in drying an adjacent enclosed storage area, such as a closet,
unless there is adequate circulation of air in and out of the area.
• Do not use outdoors.
• This dehumidier is intended for indoor residential
applications only. This dehumidier should not be used
for commercial or industrial applications.
• Place the dehumidier on a smooth, level oor strong
enough to support the unit with a full bucket of water.
• Allow at least 8” of air space on all sides of the unit for good
air circulation (at least 16” of air space on air outlet).
• Place the unit in an area where the temperature will not
fall below 41°F (5°C). The coils can become covered with
frost at temperatures below 41°F (5°C), which may reduce
performance.
• Models with pumps should not operate when the temperature
is 32°F (0°C) or below to prevent condensate from freezing
inside the drain hose and damaging the pump.
• Place the unit away from sources of heat such as clothes
dryer, heater or radiator.
• Use the unit to prevent moisture damage anywhere books or
valuables are stored.
• Use the dehumidier in a basement to help prevent moisture
damage.
• The dehumidier must be operated in an enclosed area to be
most effective.
• Close all doors, windows and other outside openings to the
room.
When using the Unit
• When rst using the dehumidier, operate the unit
continuously 24 hours. Make sure the plastic cover on the
continuous drain hose outlet is installed tightly properly so
there are no leaks.
• This unit is designed to operate with a working environment
between 41°F (5°C) and 95°F (35°C).
• If the unit has been switched off and needs to be switched on
again quickly, allow approximately three minutes for operation
to resume.
• Do not connect the dehumidier to an electrical outlet, which
is also being used for other electrical appliances.
• Select a suitable location, making sure you have easy access
to an electrical outlet.
• Plug the unit into a electrical socket-outlet with a proper
ground connection.
• Make sure the Water bucket is correctly seated in
position otherwise the unit will not operate properly.
NOTE: When the bucket is partially full, be careful moving the
machine to avoid tipping.
Casters (At four points on
the bottom of unit)
• Casters should move freely.
• Do not force casters to move over car-
pet, nor move the unit with water in the
bucket. (The unit may tip over and spill
water.)
Fig. 4a
Air outlet grille
Air intake grille
8” or more
8” or
more
16” or more
8” or
more
8” or more
AITONS EQUIPMENT

BHDP-951-H Portable Dehumidier Owner’s Manual
8
OPeraTInG THe unIT
1. Pull out the bucket a little.
2. Hold both sides of the bucket with even
strength, and pull it out from the unit.
Fig. 5
3. Pour the water out.
Fig. 6
Fig. 7 Fig. 8
Pump hose drops Reinstall pump
hose properly
Fig. 9
Remove the
plastic cover
by counter-
clockwise
rotation.
Fig. 10
Drain Hose
Removing the collected water
There are several ways to remove collected water.
1 Use the bucket
• When the unit is off, if the bucket is full, the Full indicator will light.
• When the unit is on, if the bucket is full, the compressor and the fan turn
off, and the Full indicator light will light, the digital display shows P2.
• Slowly pull out the bucket. Grip the left and right handles securely,
and carefully pull out straight so water does not spill. Do not
put the bucket on the oor because the bottom of the bucket is
uneven. Otherwise the bucket will fall and cause the water to spill.
• Throw away the water and replace the bucket. The bucket must
be in the right place and securely seated for the dehumidier to
operate.
• The machine will re-start when the bucket is restored in its
corrected position.
NOTES:
• When you remove the bucket, do not touch any parts inside of the
unit. Doing so may damage the product.
• Be sure to push the bucket gently all the way into the unit. Banging
the bucket against anything or failing to push it in securely may cause
the unit not to operate.
• If the pump hose drops when you remove the bucket (see Fig. 7),you
must reinstall the pump hose properly to the unit before replace the
bucket into the unit (see Fig. 8)
• When you remove the bucket, if there is some water in the unit you
must dry it.
• When the unit is on, if the bucket is removed, the compressor and the fan
turn off, then the unit will beep 8 times and the digital display shows Eb.
• When the unit is off, if the bucket is removed, the unit will beep 8 times
and the digital display shows Eb
2. Continuous Draining
• Water can be automatically emptied into a oor drain by attaching
the unit with a water hose (5/16” or larger, not included) with a
female threaded end (1” hose BB, not included)
• Remove the plastic cover from the back drain outlet of the unit
and set aside, then insert the drain hose though the drain outlet
of the unit and lead the drain hose to the oor drain or a suitable
drainage facility.) See. Fig. 9 and Fig. 10).
• When you remove the plastic cover, if there is some water in the
back drain outlet of the unit you must dry it. Make sure the hose
is secure so there are no leaks and the end of the hose is level or
down to let the water ow smoothly.
• Direct the hose toward the drain,making sure that there are no
kinks that will stop the water owing.
• Select the desired humidity setting and fan speed on the unit for
continuous draining to start.
NOTE: When the continuous draining feature is not being used, remove the
drain hose from the outlet, and dry the water in the continuous drain hose
outlet.
AITONS EQUIPMENT

Removing the collected water
3. Pump draining (on some models)
Water can be automatically emptied into a oor drain or a suitable
drainage facility by attaching the pump drain out with a pump drain
hose (1/4” O.D., supplied).
• Remove the continuous drain hose from the unit and install
the plastic cover to the continuous drain hose outlet of the unit by
clockwise rotation.(See Fig. 11)
• Reinsert the pump drain hose into the pump drain hose outlet to a
depth of 5/8” minimum at least (See Fig. 11), then lead
the water hose to the oor drain or a suitable drainage facility.
• Press the pump pad of the unit to activated the pump operation. When
the bucket is full the pump starts to work.
NOTE: The pump may cause big noise when it starts to work for
3~5 minutes. It is a normal phenomenon.
• Make sure the hose is secure so there are no leaks.
• Direct the hose toward the drain,making sure that there are no kinks
that will stop the water owing.
• Place the end of the hose into the drain and make sure the end of the
hose is level or down to let the water ow smoothly. Do never let it up.
• Select the desired humidity setting and fan speed on the unit for pump
draining to start.
NOTE: The pump operation on light blinks at 1Hz when the pump is in
operational failure mode. Please turn off the unit and unplug the power
cord. Check the following things.
• Cleaning the lter of the pump.
-Remove the bucket from the unit, take down the pump and clean the
lter of the pump (See Fig. 12).
• Check that the pump drain hose does not kink or block.
• Empty the water of the bucket.
• Reinstall the pump hose if it drops and reinstall the bucket properly. Turn on
the unit. If the error repeats, call for service.
NOTE: Do not use this operation when the outdoor temperature is
equal to or less than 0°C (32°F), otherwise water will become ice that
will cause the water hose to block up and unit to fail. Make sure to
empty the bucket once a week when using the pump draining feature.
When the pump draining feature is not being used, remove the pump
drain hose from the outlet.
• Press the pump drain hose outlet in and take the pump drain hose out from
it (See Fig. 13). Do not let the water in the pump hose drip to the oor.
Owner’s Manual BHDP-951-H Portable Dehumidier
OPeraTInG THe unIT
Pump drain
hose
Fig. 11
Filter of the pump
Fig. 12
Fig. 13
2. Take the
pump drain
hose out
1. Press the pump
drain hose outlet in
Pump drain
hose outlet
Reinstall the
plastic cover
9
AITONS EQUIPMENT

BHDP-951-H Portable Dehumidier Owner’s Manual
Care anD MaInTenanCe
Care and cleaning of the dehumidier
Turn the dehumidier off and remove the plug from the
wall outlet before cleaning.
1. Clean the Grille and Cabinet
• Use water and a mild detergent. Do not use bleach or abrasives.
• Do not splash water directly into the unit. Doing so may cause an
electrical shock, cause the insulation to deteriorate, or cause the unit
to rust.
• The air intake and outlet grilles may become clogged with dust, so
use a vacuum attachment with brush to clean.
2. Clean the Bucket
• Every few weeks, clean the bucket to prevent growth of mold, mildew
and bacteria. Partially ll the bucket with clean water and add a little
mild detergent. Swish it around in the bucket, empty and rinse.
NOTE: Do not use a dishwasher to clean the bucket. After clean, the
bucket must be in place and securely seated for the dehumidier to
operate.
3. Clean the Air Filter
• Remove the lter at least every two weeks based on normal
operating conditions.
• To remove the lter, pull lter outwards (See Fig. 14).
• Wash the lter with clean water then air dry.
• Re-install the lter, replace Bucket.
CAUTION:
DO NOT operate the dehumidier without a lter because the dirt and
lint will clog the coils and reduce performance.
4. When not using the unit for long time periods
• After turning off the unit, wait one day before emptying the bucket.
• Clean the main unit, water bucket and air lter.
• Wrap the cord and bundle it with the band.
• Cover the unit with a plastic bag, or use original carton.
• Store the unit upright in a dry, well-ventilated place.
Fig. 14
10
AITONS EQUIPMENT

TROUBLESHOOTING TIPS
Before calling for service, review the chart below.
Unit does not start
Dehumidier does not
dry the air as it should
The unit makes a loud
noise when operating
Frost appears
on the coils
Water on the oor
ES, AS, PS, EC, E3, or
Eb appear in the display
What to checkProblem
• Make sure the dehumidier’s plug is pushed completely
into the outlet.
• Check the house fuse/circuit breaker box.
• Dehumidier has reached its preset level or bucket is full.
• Water bucket is not seated in the proper position.
• Allow enough time to remove the moisture.
• Make sure there are no curtains, blinds or furniture blocking the
air inlets/outlets of the dehumidier.
• The humidity control may not be set low enough.
• Check that all doors, windows and other openings are securely closed.
• Room temperature is too low, below 41°F (5°C).
• There is a kerosene heater or something giving off water vapor in
the room.
• The air lter is clogged.
• The unit is tilted instead of upright as it should be.
• The oor surface is not level.
• These are error codes and protection code. See the
CONTROL PADS ON THE DEHUMIDIFIER section.
• This is normal. The dehumidier has on Auto defrost
feature.
• Hose to connector or hose connection may be loose.
• Intend to use the bucket to collect water, but the back drain
plug is removed.
11
The pump operation on
light blinks at 1Hz
• Clean the lter of the pump.
• Check the pump hose is not kinked or blocked.
• Empty the water from the bucket.
Owner’s Manual BHDP-951-H Portable Dehumidier AITONS EQUIPMENT

Before calling for service, review the chart below.
12
This page is left intentionally blank.
BHDP-951-H Portable Dehumidier Owner’s Manual
AITONS EQUIPMENT

13
Owner’s Manual BHDP-951-H Portable Dehumidier
This page is left intentionally blank.
AITONS EQUIPMENT

BHDP-951-H Portable Dehumidier Owner’s Manual
This page is left intentionally blank.
14
AITONS EQUIPMENT

'XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH
VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV'HWHUPLQLQJWKH
DSSOLFDWLRQDQGVXLWDELOLW\IRUXVHRIDQ\SURGXFWLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU
$GGLWLRQDOO\WKHLQVWDOOHULVUHVSRQVLEOHIRUYHULI\LQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW
SULRUWREHJLQQLQJDQ\LQVWDOODWLRQSUHSDUDWLRQV
,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH
DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH
KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULO\JUDQWHGIRUWKHOLIHRIDSURGXFW
7KHUHIRUHLWLVWKHUHVSRQVLELOLW\RIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF
PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV
3/2015
AITONS • 35 Brownridge Road, Unit 6, Halton Hills, ON L7G 0C6 • 1-888-744-2911 • www.aitons.com
Table of contents
Other Comfortaire Dehumidifier manuals

Comfortaire
Comfortaire 23-11-2243N-003 User manual

Comfortaire
Comfortaire BHDP-701-J User manual

Comfortaire
Comfortaire BHD-22B User manual

Comfortaire
Comfortaire DH400K0 User manual

Comfortaire
Comfortaire R-410A User manual

Comfortaire
Comfortaire DH25J2 User manual

Comfortaire
Comfortaire DH600K0 User manual

Comfortaire
Comfortaire DH40J0 User manual

Comfortaire
Comfortaire BHD-301-J User manual