Makita EK7300 User manual

Important:
Read this instruction manual carefully before putting the Power Cut into operation and strictly observe the
safety regulations!
Keep this instruction manual!
Instruction Manual
Original Instruction Manual
EK7300
EK7301
EK8100

2
Table of contents Page
Packing ................................................................................ 2
Delivery inventory .............................................................. 3
Symbols ............................................................................... 3
SAFETY PRECAUTIONS
Intended use ................................................................... 4
General precautions ....................................................... 4
Protective equipment ...................................................4-5
Fuels / Refuelling ............................................................ 5
Putting into operation ...................................................... 5
Cutting discs ................................................................... 6
Kickback and lock-in ....................................................... 7
Working behavior / Method of working ............................7
Always observe the following when using
synthetic resin cutting discs ............................................. 8
Cutting metal ................................................................... 8
Cutting masonry and concrete .....................................8-9
Transport and storage ..................................................... 9
Maintenance ................................................................. 10
First aid ......................................................................... 10
Disposal and environmental protection ......................... 10
Technical data ................................................................... 11
Denomination of components ......................................... 12
PUTTING INTO OPERATION
Mounting the cutting disc ............................................... 13
Tightening the V-belt / Checking V-belt tension ............ 14
Fuels / Refuelling .....................................................14-15
Starting the engine ........................................................ 16
Cold-starting ................................................................. 17
Warm-starting ............................................................... 17
Stop engine ................................................................... 17
Adjusting the carburetor .................................................. 18
MAINTENANCE
Changing the V-belt ...................................................... 19
Cleaning the protection hood ........................................ 20
Cleaning/changingtheairlter ..............................20-21
Replacing the spark plug .............................................. 22
Replacing the suction head .......................................... 22
Replacing the starter cable ........................................... 23
Replacing the return spring ........................................... 24
Replacing / cleaning the spark arrester screen ............. 26
Instructions for periodic maintenance ........................... 28
Cutting attachment in central / side position ................. 25
Repositioning the cutting attachment .......................25-26
SPECIAL ACCESSORIES
Diamond cutting discs, trolley, water tank
and pressure water system............................................ 27
Service, spare parts and guarantee ................................ 28
Troubleshooting ............................................................... 29
Extract from spare parts list .......................................30-31
Accessories .................................................................. 31
EU Conformity Declaration............................................... 31
Packing
Your MAKITA Power Cut is packed in a cardboard box to pre-
vent shipping damage.
Cardboard is a basic raw material and is consequently reuseable
or suitable for recycling (waste paper recycling).
Thank you for purchasing a MAKITA product!
Congratulations on choosing a MAKITA Power Cut cutoff saw!
We are condent that you will be satised with this modern
piece of equipment. Like our chain saws, the MAKITA Power
Cuts feature specially designed high-performance engines
with outstanding power-to-weight ratios, for heavy-duty yet
lightweight tools.
Other advantages of the MAKITA Power Cuts:
• Sturdy construction and high reliability.
• Maintenance-free electronic ignition, hermetically sealed to
protect against dust and moisture.
• Vibration damping with the MAKITA2-mass system (D2M) for
tireless working even when guiding the Power Cut by hand.
• Five-stageair-ltersystemforreliableworkingevenunder
very dusty conditions.
• Two options for mounting the cutter attachment: Either cen-
trally, for good balance when guiding the unit manually, or on
theside,forushcutsalongwallsorcurbsidesorhorizontally
directly above the ground.
• Extensive range of resin-bonded and diamond grit cutting
discs, trolley with dust catcher, and systems for supplying
water to the disc.
The following industrial property rights apply: DE 20013210,
DE 19737657, DE 20301182, DE 102006056924, DE
102009014688, DE 202011000529, DE 202011000531, DE
202011000534, US 5709594.
WewantyoutobesatisedwithyourMAKITAproduct.
In order to guarantee the optimal function and performance of
your Power Cut and to ensure your personal safety we would
request you to perform the following:
Read this instruction manual carefully before putting the
Power Cut into operation for the rst time, and strictly
observe the safety regulations! Failure to observe these
precautions can lead to severe injury or death!
WARNING
The ignition system of this equipment produces an electro-
magnetic eld. This eld may interfere with some medical
devices such as a pacemaker. To reduce the risk of serious
or fatal injury, persons with a medical device should consult
with their physician and the manufacturer of the device before
operating this equipment.

3
6543
21
Delivery inventory
1. Power Cut
2. Cutting disc (notinthegeneralscopeofdelivery.Country-specic)
3. Adapter ring 20/25.4 (notinthegeneralscopeofdelivery.Country-specic)
4. Screwdriver (for carburetor adjustment)
5. Offset screwdriver
6. Universal wrench 13/19
7. Instruction manual (not shown)
In case one of the parts listed should not be included in the
delivery inventory, please consult your sales agent.
Symbols
You will notice the following symbols on the Power Cut and in the Instruction Manual:
Read instruction manual and
follow the warning- and safety
precautions!
Particular care and caution!
Forbidden!
Wear helmet and eye, respiratory
and hearing protection!
Wear protective gloves!
Wear respiratory protection!
Hazardous dust and/or
gas emission!
Fire hazard from ying sparks!
No smoking!
No open re!
Direction of cutting wheel rotation
Warning: the max. peripheral
speed of the cutting disc is 80 m/s!
Cutting disc dimensions
Never use circular saw blades!
Never use damaged cutting discs!
Combination switch
Choke, Start/Stop (I/O)
Starting procedure
(Press decompression valve,
Engine - manual start)
Stop engine!
Warning!
Kickback!
Fuel and oil mixture
First aid
Recycling
CE - Marking

4
2
3
1
4
SAFETY PRECAUTIONS
Intended use
Power Cut
Use the Power Cut cutoff saw outdoors only, for trimming and cutting
suitable materials, using cutting discs rated for this machine.
Improper use:
Never use the cutoff saw cutting discs for grinding or sanding (us-
ing the side of the cutting disc to remove material). The disc can
break! Never use the Power Cut with saw blades, cutter blades,
brushes etc.
Unauthorised users:
Persons unfamiliar with the Instruction Manual, children, young
people,andpersonsundertheinuenceofalcohol,drugsormedi-
cations must not use the Power Cut.
General precautions
-The operator MUST read this instruction manual to ensure
safe operation (even if you already have experience in us-
ing cutoff saws). It is important to be familiar with the opera-
tionofthisparticularcutoffsaw.Usersinsufcientlyinformed
will endanger themselves as well as others due to improper
handling.
- Let only persons who have experience in using cutoff saws work
with this unit. When letting another person use the Power Cut,
this instruction manual must be provided along with it.
- First-time operators should ask a specialist to instruct them in
working with gasoline-powered cutoff saws.
- Children and persons under 18 years of age must not be allowed
to use this Power Cut. Persons over the age of 16 years may,
however, use the Power Cut for the purpose of being trained as
longastheyareunderthesupervisionofaqualiedtrainer.
- Working with the Power Cut requires high concentration.
- Operate the Power Cut only if you are in good physical condition.
If you are tired, your attention will be reduced. Be especially
careful at the end of a working day. Perform all work calmly and
carefully. The user has to accept liability for others.
- Neverworkwhileundertheinuenceofalcohol,drugs,medica-
tion or other substances which may impair vision, dexterity or
judgement.
- Areextinguishermustbeavailableintheimmediatevicinity
whenworkingineasilyinammablevegetationorwhenithas
notrainedforalongtime(dangerofre).
- Asbestos and other materials that can release toxins may be cut
onlywiththenecessarysafetyprecautionsandafternotication
of the proper authorities and under their supervision or that of
a person appointed by them.
- The use of dust-reduction devices is urgently recommended
(see Accessories, pressure water tank, water tank).
Protective equipment
- In order to avoid head, eye, hand or foot injuries as well as
to protect your hearing the following protective equipment
must be used during operation of the Power Cut:
- The kind of clothing should be appropriate, i. e. it should be tight-
ttingbutnotbeahindrance.Clothinginwhichgrainsofmaterial
can accumulate (trousers with cuffs, jackets and trousers with
wide-open pockets, etc.) must not be worn, particularly when
cutting metal.
- Do not wear any jewellery or clothing that can get caught or
distract from the operation of the Power Cut.
- It is necessary to wear a protective helmet whenever working
with the Power Cut. The protective helmet (A) is to be checked
in regular intervals for damage and is to be replaced after 5
years at the latest. Use only approved protective helmets.
- The helmet visor (B) protects the face from dust and material
grains. In order to prevent injuries to eyes and face, always
wear protective goggles (C) or visor when using the Power
Cut.
- To prevent hearing damage, always wear suitable personal
hearing protection. (ear muffs (D), ear plugs, etc.). Octave
brand analysis upon request.
- When dry-cutting dust-producing materials such as stone
or concrete, always wear approved respiratory protection
(E).
- Work gloves (F) of tough leather are part of the required
work kit of the Power Cut and must always be worn when
working with the Power Cut.

5
- Always wear safety shoes or boots (G) with steel toes, non-skid
soles, and leg protectors when working with the Power Cut.
Safety shoes equipped with a protective layer provide protection
against cuts and ensure a secure footing.
- Always wear a work suit (H)oftoughmaterialwithsufcient
ame-retardant qualities whenever working with the cutoff
saw.
Fuels / Refuelling
- Go to a safe, level place before refuelling. Never refuel while
on scaffolding, on heaps of material, or in similar places!
- Switch off the engine before refuelling the Power Cut.
- Donotsmokeorworknearopenres(6).
- Let the engine cool down before refuelling.
- Fuels can contain substances similar to solvents. Eyes and skin
should not come in contact with mineral oil products.Always wear
protective gloves when refuelling (not the regular work gloves!).
Frequently clean and change protective clothes. Do not breathe
infuelvapors.Inhalationoffuelvapourscanbehazardousto
your health.
- Do not spill fuel. If a spill occurs, clean off the Power Cut im-
mediately. Fuel should not come in contact with clothes. If your
clothes have come in contact with fuel, change them at once.
- Ensurethatnofueloozesintothesoil(environmentalprotection).
Use an appropriate base.
- Refuelling is not allowed in closed rooms. Fuel vapors will ac-
cumulateneartheoor(explosionhazard).
- Ensuretormlytightenthescrewcapofthefueltank.
- Before starting the engine, move to a location at least 3 meters
(approx. 3 1/4 yards) from where you fuelled the Power Cut
(7), but not within the extended swing range of the cutting disc
(direction of sparks).
- Fuel cannot be stored for an unlimited period of time. Buy only
as much as will be consumed in the near future.
- When making up the gasoline/oil mixture, always put the oil in
the mixing container rst, and then the gasoline.
- Use only approved and marked containers for the transport and
storage of fuel.
- Keep fuel away from children!
Putting into operation
- Do not work on your own. There must be someone around
in case of an emergency (within shouting distance).
- Observe all anti-noise regulations when working in residential
areas.
- Never use the Power Cut near inammable materials or
explosive gases! The Power Cut can create sparks leading
to re or explosion!
- Make sure that all persons within 30 meters (33 yards), such
as other workers, are wearing protective gear (see "Protective
Equipment")(8).Childrenandotherunauthorizedpersonsmust
remain more than 30 meters away from the working area. Keep
an eye out for animals as well (9).
- Before starting work the Power Cut must be checked for
perfect function and operating safety according to the pre-
scriptions. In particular, make sure that the cutting wheel is in
good condition(replace immediately if torn, damaged or bent),
the cutting wheel is properly mounted, the protective hood is
locked in place, the hand guard is properly mounted, the V-belt
has the proper tension, the throttle moves easily and the half-
throttle lock button functions properly, the grips are clean and
dry, and the combination switch functions properly (Start/Stop
(I/O) switch, choke).
- Start the Power Cut only after complete assembly and inspec-
tion. Never use the Power Cut when it is not completely as-
sembled.
7
6
5
9
8
30 m
3 meters
= wearing Protective Equipment

6
10
11
13
12
min. 5 m
14
● Maintenance
● Refuelling
● Changing cutoff discs
●Repositioning the
cutting attachment
● Stopping work
● Transport
● Putting out of function
Cutoff discs
- The protection hood must always be on! Change discs only
with the engine off!
- There are two basic types of cutoff discs:
- For metal (hot cutting)
- For masonry (cold cutting)
NOTE:
When using diamond cutoff discs, always make sure to observe
the "direction of rotation" markings. Diamond discs should only be
used for cutting masonry/brick/ concrete etc.
- Cutoff discs are intended only for radial loading, i.e. for cutting.
Do not grind with the sides of the cutting disc! This will break
the disc (10)!
Caution!
Never change direction (turning radius less than 5 meters /
5 1/2 yards), exert lateral (sideways) pressure, or tip the Power
Cut during cutting (11)!
- Use a cutting disc only for cutting the materials it is intended
for. The proper type of disc must be used, for either metals or
masonry.
- Thearborholeofthecuttingdiscmustbeanexacttwiththe
arbororshaft.Ifthearborholeislarger,itmustbettedwithan
adapter ring (available as an accessory).
- The cutting disc must be rated for freehand cutting at up to 3850
rpm or 80 m/sec for 400 mm discs, 4370 rpm or 80 m/sec for
350 mm discs, or up to 5100 rpm or 80 m/s for 300 mm discs.
Use only cutting discs that comply with EN 12413, EN 13236.
- The disc must be free of defects (12). Do not use defective cut-
ting discs.
Always tighten the cutting disc mounting bolt to a torque of 30
Nm. Otherwise, the cutting disc can twist.
- Before starting the cutting disc, make sure you have a steady
footing.
- Put the Power Cut into operation only as described in this instruc-
tion manual (13). Always place your left foot in the rear handle
andgrasptheotherhandlermly(withthumbandngers).Other
starting methods are not allowed.
- When starting the Power Cut it must be well supported and
securely held. The cutting disc must not be touching anything.
- If the cutting disc is new, test it by running it at least 60 seconds
at top speed. When doing this, make sure that no persons or
body parts are in the extended swing range of the disc, in case
itisdefectiveandiesapart.
- When working with the Power Cut always hold it with both
hands. Take the back handle with the right hand and the tubu-
lar handle with the left hand. Hold the handles tightly with your
thumbsfacingyourngers.
- CAUTION: When you release the throttle lever the disc will
keep spinning for a short period of time (free-wheeling effect).
- Continuously ensure that you have a safe footing.
- Hold the Power Cut such that you will not breathe in the exhaust
gas. Do not work in closed rooms or in deep holes or ditches
(danger of poisoning by fumes).
- Switch off the Power Cut immediately if you observe any
changes in its operating behavior.
- Switch off the engine before inspecting the V-belt tension
or tightening it, replacing the cutting wheel, repositioning
the cutter attachment (side or middle position) or eliminating
faults (14).
- Turn off the engine immediately and check the disc if you hear
or feel any change in cutting behaviour.
- Turn off the Power Cut when taking a break or stopping work
(14). Place the unit in such a way that the disc is not touching
anything and cannot endanger anyone.
- Do not put the overheated Power Cut in dry grass or on any
inammableobjects.Themuferisveryhot(dangerofre).
- IMPORTANT:Afterwetcutting,rstturnoffthewaterfeedand
thenletthediscrunatleast30seconds,toingofftheremaining
water and prevent corrosion.

7
Kickback and lock-in
- When working with the Power Cut there is a danger of kickback
and lock-in.
- Kickback occurs when the top of the cutting disc is used for
cutting (15).
- This causes the Power Cut to be thrown back toward the user
with great force and out of control. Risk of injury!
To prevent kickback, observe the following:
- Nevercutwiththesectionofthecuttingdiscshowningure15.
Be especially careful when reinserting the disc into cuts
that have already been started!
- Lock-in occurs when the cut narrows (crack, or workpiece under
stress).
- This causes the Power Cut to suddenly jump forward, out of
control and with great force. Risk of injury!
To prevent lock-in, observe the following:
- When reinserting the disc into previous cuts, have the Power
Cut running at top speed. Always cut at top speed.
- Always support the workpiece so that the cut is under tension
(16), so that the cut does not press together and jam the cutting
disc as it proceeds through the material.
- When starting a cut, apply the disc to the workpiece with care.
Do not just shove it into the material.
- Never cut more than one piece at a time! When cutting, make
sure that no other workpiece comes into contact.
Working behavior / Method of working
- Before starting work, check the work area for any hazards
(electrical wires, inammable substances). Clearly mark the
work area (for example with warning signs or by cordoning off
the area).
- WhenworkingwiththePowerCutholditrmlybythefrontand
rear handles. Never leave the Power Cut unattended!
- Use the Power Cut at high speed as far as possible (see “Tech-
nical Data”).
- Only use the Power Cut during good light and visibility periods.
Be aware of slippery or wet areas, and of ice and snow (risk of
slipping).
- Never work on unstable surfaces. Make sure that there are no
obstacles in the working area, risk of stumbling. Always ensure
that you have a safe footing.
- Never cut above your shoulder height (17).
- Never stand on a ladder to cut (17).
- Never use the Power Cut while standing on scaffolding.
- Do not lean over too far when working. When putting down and
picking up the Power Cut, do not bend over from the waist, but
instead bend in the knees. Save your back!
- Guide the Power Cut in such a way that no part of your body
is within the extended swing range of the disc (18).
- Use cutting discs only for the materials for which they are de-
signed!
- Use cutting discs only for the materials for which they are de-
signed. Do not use the Power Cut to lift up and shovel
away pieces of material and other objects.
Important! Before cutting, remove all foreign objects, such as
rocks, gravel, nails etc. from the cutting area. Otherwise, such
objectscanbeungawaybythediscwithgreatspeed.Injury
hazard!
- Whencuttingworkpiecesdowntolengthusearmsupport.
If necessary, secure the workpiece from slipping, but do not
steady it with your foot or allow another person to hold it.
- When cutting round items, always secure them against rota-
tion.
- When guiding the Power Cut by hand, use the side mounting
position of the cutter attachment only when actually necessary.
Otherwise, always use the central position. This gives the unit
a better balance, for reduced operator fatigue. 18
16
17
15

8
When using synthetic resin cutting discs, always ob-
serve the following:
CAUTION:
- Synthetic resin cutting discs can absorb moisture. This
moisture can cause the disc to become unbalanced at high
speed. This imbalance can cause the disc to break.
- Do not cool resin cutting discs with water or other uids.
- Do not expose resin cutting discs to high humidity or
rain!
Do not use resin cutting discs past their use-by date (expira-
tion date)! The date (quarter and year) is stamped on the disc’s
arbor ring.
EXAMPLE: 04 / 2019
This cutting disc can be used through the end of the fourth quarter
of 2019, if properly stored and correctly used.
Cutting metals
IMPORTANT!
Always wear approved respiratory protection!
Materials that can release toxic substances may be cut only
after notifying the proper authorities and under their supervi-
sion or that of a person appointed by them.
CAUTION!
The rapid rotation of the cutting disc heats metal and melts it
at the point of contact. Swing the guard as far down as pos-
sible (19) in order to direct the stream of sparks forward, away
from the operator(rehazard).
- Determine the cut line, mark the cut and apply the disc to the
material at moderate speed, to cut a guide groove before going
to top speed and applying more pressure to the Power Cut.
- Keep the disc straight and vertical. Do not tip it, as this can
break it.
- The best way to get a good, clean cut is to pull or move the
Power Cut back and forth. Do not simply press the disc into
the material.
- Thick round stock is best cut in stages (20).
- Thin tubing and pipes can be cut with a simple downward
cut.
- Cut large-diameter pipes as for round stock. To prevent tipping
and for better control, do not let the disc sink too deeply into
the material. Instead, always cut shallow around the whole
piece.
- Worn discs have a smaller diameter than new discs, so that at
the same engine speed they have a lower effective circumfer-
ential speed and therefore do not cut as well.
- Cut I-beams and L-bars in steps; see Figure 21.
- Cut bands and plates like pipes: along the wide side with a long
cut.
- When cutting material under stress (supported material or mate-
rial in structures), always make a notch in the thrust (pressure)
side, and then cut from the tension side, so that the disc does
not lock in. Secure cutoff material from falling!
CAUTION!
If there is a chance that the material is under stress, be pre-
pared for it to kick back. Make sure you can get out of the
way if you have to!
Be particularly careful in scrap-metal yards, junkyards, at ac-
cident sites, and with haphazard piles of material. Precariously
balanced pieces or pieces under stress can act in unpredictable
ways, and may slide, jump out, or burst. Secure cutoff material
from falling! Always exercise extreme caution and use only
equipment that is in perfect working order.
Observe the accident-prevention rules and regulations of your
employer and/or insurance organization.
19
20
21
Cutting masonry and concrete
IMPORTANT!
Always wear approved respiratory protection!
Asbestos and other materials that can release toxic sub-
stances may be cut only after notifying the proper authorities
and under their supervision or that of a person appointed
by them. When cutting prestressed and reinforced concrete
piles, follow the instructions and standards of the respon-
sible authorities or the builder of the structural member.
Reinforcement rods must be cut in the prescribed sequence
and in accordance with applicable safety regulations.
NOTE:
Mortar, stone, and concrete develop large quantities of dust during
cutting. To increase the lifetime of the cutting disc (by cooling),
to improve visibility, and to avoid excessive dust creation, we
strongly recommend wet cutting instead of dry cutting.

9
In wet cutting, the disc is wetted at an equal rate on both sides by
a trickle of water. MAKITA offers the right accessories for all wet
cutting applications (see also "SPECIAL ACCESSORIES").
- Remove foreign objects such as sand, stones and nails found
within the working area. Caution: Watch out for electric wires
and cables!
The rapid rotation of the cutting disc at the point of contact
throws fragments out of the cut groove at high speed. For
your safety, swing the protection hood down as far as pos-
sible (23), so that material fragments are thrown forward,
away from the operator.
- Mark the cut, and then make a groove about 5 mm (just under
1/5") along the entire length of the planned cut. This groove will
then guide the Power Cut accurately guring the actual cutoff.
NOTE:
For long, straight cuts we recommend using a trolley (24, see
also "SPECIAL ACCESSORIES"). This makes it much easier to
guide the unit straight.
- Perform the cut with a steady back-and-forth motion.
- Whencuttingslabstosize,youneednotcutthroughtheentire
material thickness (creating unnecessary dust). Instead, simply
make a shallow groove, and then knock off the excess material
cleanlyonaatsurface(25).
CAREFUL!
When cutting into lengths, cutting through material, making cutouts,
etc., always make sure to plan the direction and sequence of cuts
in such a way that the disc does not get jammed by the cut-off
piece, and that no persons can be injured by falling pieces.
Transport and storage
- Always turn off the Power Cut when transporting it or
moving it from place to place on a site (26).
- Never carry or move the unit with the engine on or the
disc moving!
- Carry the unit only by the tubular (middle) handle with the cut-
ting disc pointing behind you (26). Avoid touching the exhaust
mufer(burnhazard!)
- When moving the Power Cut over longer distances, use a
wheelbarrow or wagon.
- When transporting the Power Cut in a vehicle, make sure it is
securely positioned in such a way that no fuel can leak out.
Always remove the cutting disc before transporting the unit in
a vehicle.
- The Power Cut should be stored safely in a dry place. It must
not be left outdoors! Always dismount the cutting disc before
storage. Keep the Power Cut away from children.
- Before long-term storage and before shipping the Power
Cut, follow the instructions in the chapter on "Periodic
care and maintenance". ALWAYS empty the fuel tank and
run the carburetor dry.
- When putting cutting discs in storage, be careful to:
• Clean and dry them well. CAUTION: Do NOT clean synthetic
resincuttingdiscswithwaterorotheruids!
• Storethemlyingdownat.
• Avoiddampness,freezingtemperatures,directsunshine,
hightemperaturesandtemperatureuctuations,asthese
can cause breakage and splintering.
• Before re-using a resin cutting disc, make sure of the use-by
(expiration) date (quarter and year, stamped on the arbor
ring). If this date has been exceeded, do NOT use the cutting
disc.
- Always check new cutting discs or cutting discs that have
been in storage to make sure that they are free of defects
and beforetherstcuttest-runthetoolattopspeedforat
least 60 seconds. Keep body parts and people well away out
of range of the direction of the cutting disc during this test.
23
26
25
24

10
Maintenance
- Before performing maintenance work switch off the Power
Cut (27) and pull out the plug cap.
- Always check the Power Cut before using it to make sure that
it is in good working order. In particular, make sure that the
cutting disc is properly mounted. Make sure that the cutting
wheel is undamaged and suitable for the job it will be used
for.
- Operate the Power Cut only at a low noise and emission level.
For this ensure the carburetor is adjusted correctly.
- Clean the Power Cut regularly.
- Check the fuel tank cap regularly for good sealing.
Observe the accident prevention instructions issued by
trade associations and insurance companies. NEVER
make any modications to the Power Cut! You will only
be putting your own safety at risk!
Perform only the maintenance and repair works described in
the instruction manual. All other work must be carried out by
MAKITA Service.
Use only original MAKITA spares and accessories.
The use of non-MAKITA spares, accessories, or cutting discs
increases the risk of accident. We cannot accept any respon-
sibility for accidents or damage occurring in association with
the use of cutting discs or accessories other than original
MAKITA.
First aid
For the event of a possible accident, please make sure that a
rstaidkitisalwaysimmediatelyavailablecloseby.Immediately
replaceanyitemsusedfromtherstaidbox.
When calling for help, give the following information:
- Place of the accident
- What happened
- Number of injured people
- Kind of injuries
- Your name!
NOTE
Individuals with poor circulation who are exposed to excessive
vibration may experience injury to blood vessels or the nervous
system.
Vibrationmaycausethefollowingsymptomstooccurinthen-
gers, hands or wrists: ”Falling asleep” (numbness), tingling, pain,
stabbing sensation, alteration of skin colour or of the skin. If any
of these symptoms occur, see a physician!
To reduce the risk of vibration white nger, keep your hands
warm, wear gloves, and make sure the cutting tool is sharp.
Disposal and environmental protection
Be mindful of the environment!
Dispose of worn-out or defective cutting discs in accordance with
your local disposal regulations. To protect unusable cutting discs
from misuse, destroy them before disposal.
When the Power Cut is worn out or damaged beyond repair, have
it disposed of or recycled in an environmentally sound manner. If
necessary, consult your local authorities.
27
28
29
SERVICE

11
Displacement cm3 73
Bore mm 50
Stroke mm 37
Max. power / operating speed
kW/1/min
3.8 / 9.150
Max. torque Nm 4.3
Idling speed 1/min 2.500
Clutch engagement speed 1/min 3.800
Engine speed limitation 1/min 9.400 ± 145
Max. spindle speed 1/min 4.300
Sound pressure level LpA, eq per EN 19432 1) 4) 6) dB(A) 99,6 / KpA=2,5
Sound power level LWA, eq per EN 19432 1) 6) dB(A) 109,7 / KWA=2,5
Vibration acceleration ahv, eq per EN 19432 1) 6)
- Tubular handle m/s2 8,4 / K=2
- Rear handle m/s25,9 / K=2
Carburetor (diaphragm carburetor) Type WALBRO WJ-126 / WJ-131
Ignition system (with speed limitation) Type electronic
Spark plug Type
NGK BPMR 7A / BOSCH WSR 6F / CHAMPION RCJ 6Y
Electrode gap mm 0.5
Fuel consumption at max. load per ISO 8893 kg/h 1.7
Specicconsumptionatmax.loadperISO8893 g/kWh 450
Fuel tank capacity cm31.100
Mixture ratio (fuel/two-stroke oil)
- when using MAKITA oil 50:1
- when using other oils (quality grade: JASO FC or ISO EGD) 50:1
- when using Aspen Alkylat (two-stroke fuel) 50:1 (2%)
Cutting disc for 80 m/sec. 2) mm 300 / 20.0 / 5 3) 350 / 20.0 / 5 3)
Cutting disc for 80 m/sec. 2) 5) mm --- 350 / 25.4 / 5 3)
Arbor diameter mm 20.0 20.0 (25.4) 5)
Flange minimum outer diameter mm 100
V-belt no. 965 300 470
Overall weight (tanks empty, without cutting disc) kg 9.8 10
Technical data EK7300 EK7301
Displacement cm3 81
Bore mm 52
Stroke mm 38
Max. power / operating speed
kW/1/min
4,2 / 9.150
Max. torque Nm 5,0
Idling speed 1/min 2.500
Clutch engagement speed 1/min 3.800
Engine speed limitation 1/min 9.350 ± 145
Max. spindle speed 1/min 3.820
Sound pressure level LpA, eq per EN 19432 1) 4) 6) dB(A) 100,3 / KpA=2,5
Sound power level LWA, eq per EN 19432 6) 7) dB(A) 110,3 / KWA=2,5
Vibration acceleration ahv, eq per EN 19432 1) 6)
- Tubular handle m/s2 8,6 / K=2
- Rear handle m/s25,3 / K=2
Carburetor (diaphragm carburetor) Type WALBRO WJ-126 / WJ-131
Ignition system (with speed limitation) Type electronic
Spark plug Type
NGK BPMR 7A / BOSCH WSR 6F / CHAMPION RCJ 6Y
Electrode gap mm 0,5
Fuel consumption at max. load per ISO 8893 kg/h 1,85
Specicconsumptionatmax.loadperISO8893 g/kWh 450
Fuel tank capacity cm31.100
Mixture ratio (fuel/two-stroke oil)
- when using MAKITA oil 50:1
- when using other oils (quality grade: JASO FC or ISO EGD) 50:1
- when using Aspen Alkylat (two-stroke fuel) 50:1 (2%)
Cutting disc for 80 m/sec. 2) mm 400 / 20,0 / 5 3)
Cutting disc for 80 m/sec. 2) 5) mm 400 / 25,4 / 5 3)
Arbor diameter mm 20,0 (25,4) 5)
Flange minimum outer diameter mm 100
V-belt no. 965 300 481
Overall weight (tanks empty, without cutting disc) kg 10,6
1) Data apply to idle and rated speed operation at a ratio of 1/7 to 6/7. 2) Circumference speed at max. engine speed.
3) Outside diameter / arbor hole / thickness. 4) At the workplace (at user's ear). 5) Country-specic.6) Uncertainty (K=). 7) Data apply rated speed operation.
EK8100

12
Denomination of components
1 Handle
2 Filtercoverforairlterandsparkplugcap
3 Cover lock
4Tubular handle
5 Mufer
6 Protection hood
7Grip
8V-belt tension adjusting screw
9Retaining nuts
10 Stand
11 Carburetor adjustment opening
12 Identicationplate
13 Fuel tank with handle
14 Decompression valve
15 Starter grip
16 Air intake
17 Combinationswitch„Choke,Start/Stop(I/O)”
18 Safety locking button
19 Throttle lever
20 Tank cap (fuel)
21 Starter housing with starter
22 Cutting disc
23 Disc bolt
24 Spring washer
25 Hold opening
Serial number
Year of manufacture
Identication plate (12)
Indicate when ordering spare parts
1
2
3 4 5 6 7
8
25
9
1012 111314
24
23
17
22
18
19
20
21
15 16
EK7301
2014 123456
XXX.XXX.XXX Typ XXX
Makita Corporation, Anjo, Aichi, Japan
Made in Germany

13
Place the spring washer (8) on the arbour and insert the screw
(9) and tighten by hand.
Turn the disc slowly until the stop hole of the V-belt pulley is
visible in the cutting arm cover (10).
Insert the Allen key (2) as far as it will go. The shaft is now
blocked.
Tighten the screw with the combination wrench (1)
NOTE: Tighten the screw rmly (30 ± 2 Nm), as otherwise
the cutting wheel may slip during cutting.
PUTTING INTO OPERATION
CAUTION:
Always turn off the engine and pull off the spark plug cap
before doing any work on the Power Cut! Always wear
protective gloves!
CAUTION:
Start the Power Cut only after complete assembly and
inspection.
Mounting the cutting disc
Inspect the disc for damage.
See SAFETY INSTRUCTIONS, Page 6.
Unscrew screw (9) and remove the spring washer (8).
Place the cutting disc (5) on the arbour (7).
CAUTION: The arbor hole of the cutting disc must be an exact
twiththearbororshaft.Ifthearborholeislarger,itmustbe
tted with an adapter ring (*). Non-compliance can cause
serious injury!
Make sure the cutting disc is installed so it turns in the right
direction, if a direction is marked on the disc.
Sequence
For the the following work, use the assembly tools included
with delivery:
1. 13/19 AF combination wrench
2. Allen key
3. Carburetor adjustment screwdriver
4. Adapter ring (not in the general delivery inventory)
Place the Power Cut on a stable surface and carry out the fol-
lowing assembly steps:

14
NOTE: The two fastening nuts (11) must be loosened before
tightening the V-belt or checking the tension.
To increase the belt tension, turn the tightening screw (12) to
the right (clockwise) with the combination wrench included with
the Power Cut.
The belt tension is correctly adjusted when the nut (13) is cen-
tred on the mark (14).
IMPORTANT:
After tightening/inspection, make certain to tighten
the fastening nuts (11) (30 ± 2 Nm).
Tightening the V-belt /
Checking V-belt tension
IMPORTANT:
Exact V-belt tension is essential for maximum cutting per-
formance with minimum fuel consumption. Improper V-belt
tension will result in premature wear to the V-belt and V-belt
wheel or damage to the clutch bearing.
If the Power Cut is new or the V-belt has been replaced,
retighten the V-belt after the rst hour of operation!
Fuels
Caution:
This tool uses mineral-oil products (gasoline and oil).
Be especially careful when handling gasoline.
Do not smoke. Keep tool well away from open ames, spark,
or re(explosionhazard).
Fuel mixture
This tool is powered by a high-performance air-cooled two-stroke
engine. It runs on a mixture of gasoline and two-stroke engine
oil.
The engine is designed for unleaded regular gasoline with a
min. octane value of 91 ROZ. In case no such fuel is available,
you can use fuel with a higher octane value. This will not affect
the engine.
In order to obtain an optimum engine output and to protect
your health and the environment use unleaded fuel only.
To lubricate the engine, use a synthetic oil for two-stroke air-
cooled engines (quality grade JASO FC or ISO EGD), which
has to be added to the fuel. The engine is designed for the use
of MAKITA high-performance two-stroke engine oil at a mixture
ratio of only 50:1 to protect the environment. In addition, this
ensures a long service life and reliable operation with minimum
exhaust emissions.
Gasoline 50:1
50:1
+
The correct mixture ratio:
50:1 when usingMAKITAhigh-performance two-stroke
engine oil, i. e. mix 50 parts gasoline with 1 part
oil.
50:1 When using other synthetic two-stroke engine
oils (quality grade JASO FC or ISO EGD), i. e.
mix 50 parts gasoline with 1 part oil.
OIL
50:1
1000 ml
(1 litre) 20 ml 20 ml
5000 ml (5 litre) 100 ml 100 ml
10000 ml (10 litre) 200 ml 200 ml

15
Refuelling
IMPORTANT:
FOLLOW THE SAFETY PRECAUTIONS!
Be careful and cautious when handling fuels.
The engine must be turned off and cooled down!
Carefullycleantheareaaroundthefuel-tankllernecktokeep
dirt from getting in the tank.
Place the unit on its side on an even surface.
Unscrewthetankcapandlltankwithfuelmixture.Takecare
to avoid spilling.
Screw the tank cap back on hand-tight.
Clean screw cap and tank after refuelling. Never start or op-
erate the Power Cut in the same place as it was fuelled!
If fuel gets on your clothing, change clothes immediately.
Fuel mixture
The Storage of Fuel
Fuels have a limited storage life. Fuel and fuel mixtures
age through evaporation, especially at high temperatures.
Aged fuel and fuel mixtures can cause starting problems
and damage the engine.Purchase only that amount of fuel,
which will be consumed over the next few months. At high
temperatures, once fuel has been mixed it should be used
up in 6-8 weeks.
Store fuel only in proper containers, in dry, cool, secure
locations!
AVOID SKIN AND EYE CONTACT
Mineral oil products degrease your skin. If your skin comes in
contact with these substances repeatedly and for an extended
period of time, it will dry out. Various skin deseases may result.
In addition, allergic reactions are known to occur.
Eyes can be irritated by contact with oil. If oil comes into your
eyes, immediately wash them with clear water.
If your eyes are still irritated, see a doctor immediately!
MAKITA high-performance two-stroke engine oil (50:1) is
availableinthefollowingsizestosuityourindividualrequire-
ments:
100 ml order number 980 008 606
1 l order number 980 008 607
NOTE:Forpreparingthefuel-oilmixturerstmixtheentireoil
quantity with half of the fuel required, then add the remaining
fuel.Shakethenishedmixturethoroughlybeforepouringit
into the tank.
Caution: Open the tank cap carefully, as pressure might
have built up inside!
It is not wise to add more engine oil than specied to
ensure safe operation. This will only result in a higher
production of combustion residues which will pollute the
environment and clog the exhaust channel in the cylinder
as well as the mufer. In addition, fuel consumption will
rise and performance will decrease.

16
Starting the engine
Thismodelisttedwithasemiautomaticdecompressionvalve
(1) to make starting easier. Press the rubber cover until you
can feel it engage. This pushes in the deompression valve
behind it. This in turn reduces the compression, so that it takes
less force to pull the starter cord to accelerate the engine to its
starting speed.
The high pressure in the combustion chamber after the rst
ignition automatically closes the decompression valve.
if
necessary
CAUTION:
Observe the SAFETY INSTRUCTIONS on page 4 and 5!
Start the Power Cut only after complete assembly and
inspection!
Move at least 3m away from the place where you fuelled
the Power Cut.
Make sure you have a good footing, and place the Power
Cut on the ground in such a way that the cutting disc is
not touching anything.
3 meters
Move the protective hood (3) into the proper position for the
work you intend to do (see illustration).
Grasp the grip (2). The hood (3) can swing in both ways within
its range of motion.
Caution:
Always make sure that the straight outer edge of the impact plate
(4) and the edge of the hood are parallel (see arrows).
If this is not the case, take the tool to a service centre.

17
Stopping the engine
Push the combination switch (6) down to position .
Cold start (Choke)
Warm start
Engine off
6
5
8
9
6
Cold starting:
GraspfronthandlermlywithonehandandpressthePower
Cut against the ground.
Place left toe in the rear handguard.
Push the combination switch (6) up (choke position). This will
automatically activate the half-throttle lock.
NOTE: If the Power Cut is mounted on the trolley, do not
operate the gas lever (throttle) on the side of the trolley!
Pull the starter cable out slowly until you feel resistance (piston
is now just before top dead center).
Press in the decompression valve (5).
Pull starter cable quickly and rmly, until you hear the rst
ignition, but to a max. of 3-5 pulls!
Important: Do not pull the starter cable out more than about
50 cm / 20”, and guide it back slowly by hand (instead of letting
it snap back).
Press in the decompression valve (5).
Move the combination switch (6) to the middle “I” position.
Againpullthestartercablequicklyandrmly.
As soon as the engine is running, grasp the rear handle (the
safety lock switch (8)will be depressed by the palm of your hand)
and tap the throttle (9). The half-throttle lock will be disengaged
and the engine will run in idle.
Warm starting:
As described above for cold starting, but before starting push
the combination switch (6) up (Choke position) and then right
away back to the middle “I” position.
Thisisonlytoengagethehalf-throttlelock.Iftheenginedoesn’t
start after 2 or 3 pulls, repeat the entire starting procedure as
described for cold starting.
Do not leave switch (6) in the choke position when hot
starting!

18
Adjusting
the carburetor
NOTE: The grinding parts are equipped with an electronic
ignition to limit the speed.
At the factory the idling speed has been set to approx.
2500 rpm, but the running-in process of a new engine may
require slight readjustment of the idling speed.
Adjustments to the adjusting screws (L) and (H) may only
be made by an authorised MAKITA service centre. Accor-
dingly, the holes for the two screws are sealed shut.
For correct adjustment of the idling speed the following
steps must be carried out:
Start the engine and run it until it is warm (about 3 - 5
minutes).
Adjust the carburetor with the screwdriver (1, Order No. 944
340 001) included with the Power Cut. It has a lug that helps
with adjustment.
Readjust the idling speed.
If the cut-off disc is still turning when the engine is running,
unscrew the adjusting screw of the throttle valve (2) until the
cut-off disc is no longer turning. When the engine is left running
at idling speed, tighten the screw a little.
Switch off the engine

19
MAINTENANCE
CAUTION:
Before doing any work on the Power Cut turn off the engine,
remove the cutting disc, pull the plug cap off the spark plug
and wear protective gloves!
CAUTION:
Start the Power Cut only after complete assembly and
inspection.
IMPORTANT:
Because many of the parts and assemblies not mentioned
in this Instruction Manual are vital to the safety of the
unit, and because all parts are subject to a certain amount
of wear and tear, it is important for your own safety that
you have the unit checked and maintained regularly by a
MAKITA service center.
IMPORTANT:
If the cutting wheel breaks during cutting, the
Power Cut must be repaired by a MAKITA service
centre before being used again!
SERVICE
Changing the V-belt
Loosen nuts (3).
Loosen the tightening screw (1) (counter-clockwise) until the
end of the screw (2) is visible in the gap.
Loosen and unscrew the screw (detail X, only for EK8100).
Unscrew the nuts (3) and remove the cover (4).
Remove the screws (5) and (7) and remove the side piece
(6).
NOTE:
Screw (5) is longer than screws (7). Make sure
to put them back in the right places during reas-
sembly!
Unscrew the screws (8) and remove the crankcase housing
cover (9).
Remove the old belt (10) or belt pieces.
NOTE: The illustration shows the V-belt for models EK7300,
EK7301.
Clean out the inside of the drive arm with a brush.
Put in a new V-belt.
NOTE:
Reassemble the crankcase housing cover (9), side piece (6)
and cover (4) in the reverse order.
To tighten the V-belt see ”Tightening the V-belt / Checking
V-belt tension”.

20
Cleaning the protection hood
Over time, the inside of the protective hood can become caked
with material residue (especially from wet cutting), which if
allowed to accumulate can hinder the free rotation of the cut-
ting disc. For this reason the hood must be cleaned out from
time to time.
Take off the cutting wheel with spring washer and remove the
accumulated material from inside the hood with a strip of wood
or similar implement.
Clean the shaft and all removed parts.
NOTE: To install the cutting wheel see ”Mounting the cutting
wheel”.
Cleaning / changing the air lter
Turn the cover lock (11) counterclockwise to release it, and
carefullyremovetheltercover(12).
There is a gasket (15)betweentheltercover(12) and the
hood (14).
Remove screws (13) and take off the cover (14).
Clean the gasket (15) with a brush, and check for damage.
Takethepre-lter(foam,17)outoftheltercover.
Pulltheairlterinsert(papercartridge,18) out of the cover.
Removetheinnerlter(16) from the intake opening.
Note:
Do not allow dirt to get into the carburetor!
Switch the combination switch to ”Choke” or cover the carbure-
tor with a clean cloth.
Other manuals for EK7300
2
This manual suits for next models
2
Table of contents
Other Makita Saw manuals

Makita
Makita LS1219 User manual

Makita
Makita M4302 User manual

Makita
Makita N5900B User manual

Makita
Makita 2416S User manual

Makita
Makita HS7100K Manual

Makita
Makita JR3060T User manual

Makita
Makita DJR186ZK User manual

Makita
Makita LS0714 User manual

Makita
Makita DSP601ZJU User manual

Makita
Makita JR3000VT User manual

Makita
Makita DLS600 User manual

Makita
Makita LS1011N Manual

Makita
Makita JR3060T User manual

Makita
Makita 2107F User manual

Makita
Makita 5704R User manual

Makita
Makita DLS714 User manual

Makita
Makita 5705R User manual

Makita
Makita PB002G User manual

Makita
Makita 5703R User manual

Makita
Makita 5007NB User manual