Nortel Passport 4400 Series Assembly instructions

Passport 4400
Hardware Installation Manual
Part Number 800-1951-20 Rev. A
June 1998

ii
Notice of Filing
Declaration of CE Conformance (for International sales)
A Declaration of CE Conformance is on file at the Nortel addresses shown below. The declaration lists the
models described in this manual. If the unit carries the CE mark, this declaration certifies that it meets the
specific EMC standards and safety (LVD) standards required for CE marking. If the product is a module, the
module is CE-compliant only if it is placed in a CE-marked base unit.
Any units not carrying the CE approval are not CE-compliant. Modules placed in these units may not meet
emission standards for CE compliance.
Notice
NORTEL CONFIDENTIAL: The information contained in this document is the property of Nortel’s Except as
specifically authorized in writing by Nortel, the holder of this document shall keep the information contained
hereinconfidentialandshallprotectsameinwholeorinpartfromdisclosureanddisseminationtothirdparties
and use same for evaluation, operation, and maintenance purposes only.
Notice
Specifications, tolerances, and design characteristics described in this manual are subject to change without
notice.
Nortel
MICOM Communications Corp.
4100 Los Angeles Avenue
Simi Valley, California 93063-3397
U.S.A.
[phone]
Nortel
MICOM Communications Corp. (Europe) Ltd.
The Granary
Tongham, Surrey GU10 1DW
England, UK
44 1252 781 777

iii
Safety Warnings and Cautions
Various safety agencies request statements of warning or caution to help you
in the safe operation of the unit. These statements also apply to any and all
modules installed within the unit.
To ensure adequate cooling of the
equipment a 2.0 inch unobstructed
space must be maintained around all
sides of the unit.
Um die Kühlung des Gerätes nicht zu
beschränken,istesnotwendigumdas
Gerät herum an allen Seiten ca 5 cm
Raum zu lassen.
Pour assurer un refroidissement
adéquat, maintenir un espace libre de 5
cm (2 pouces) tout autour de l’appareil.
Theacpowersocketshallbeinstalled
neartheequipmentandshallbeeasily
accessible.
StellenSiedasGerätinderNäheeiner
geerdeten Schutzkontakt- steckdose
soauf,dassdieseleichterreichbarund
zugänglich ist.
Installer la prise AC à proximité de l’ap-
pareil, dans un rayon d’accès facile.
Installation and access to the interior
of this unit shall be made only by a
qualified technician.
Die Montage und der Zugang ins In-
nere des Gerätes sind nur einem qual-
ifizierten Techniker gestattet.
L’installation et l’ouverture de cet appa-
reil est permise par un technicien au-
torisé seulement.
Connectiontothenetworkistobedis-
connected before the (mains) plug is
removed.
Ehe der Netzstecker aus der Steck-
dosegezogenwird,müssensämtliche
äusserliche Verbindungen vom Gerät
getrennt werden.
Avantde débrancherla prise decourant,
assurer que toutes les connexions ex-
ternes ont été déconnecté de l’appareil.
Warning Warnung Avertissement
Remove power plug from the power
socket before performing any service
work on the unit.
Vor öffnen des Gerätes, muss der
Netzstecker aus der Steckdose gezo-
gen werden.
Débrancher la prise de courant avant
d’entreprendre aucun travail de répara-
tion de l’appareil.
The power supply is auto-ranging in
this model. Netzteil ist mit automatischer Um- schaltung entsprechend der Versor-
gungsspannung versorgt.
Ce modèle s’adapte automatique- ment
au courant électrique ou voltage de la
prise murale.
The power supply cordset to be sup-
plied in Europe must have 0.752mm,
3 conductor “HAR” cord type
H05VV-F, terminated in a grounding
type Shucko plug on one end and a
molded-on IEC 320 connector on the
other end.
Die Netzleitung sollte ein harmonisi-
erter Typ (HAR) sein, mit der Beze-
ichnungH05VV-FoderH05VVH2-F,
3G 0.752mm, mit einem Schutzkon-
takt - und einem Kaltgerätestecker
(IEC 320).
EnEurope, brancher l’appareil à laprise
murale au moyen d’un fil “HAR” com-
prenant 3 cables H05VV-F ou
H05VVH2-F de 0.752mm chacun, avec
à une extremité une prise de terre genre
SHUCKOetàl’autreunepriseIEC320.
Technical Data Technische Daten Donnees Techniques
Passport 4400 Series
ac units
Input Voltage: 100-240 Vac
-5%, +10%
Input Current: 3A/1.5A
Frequency: 47-63 Hz
dc units
Input Voltage: 36-72 Vdc
Input Current: 5A
Passport 4400 Series
ac Geraete
Nennspannung: 100-240 V∼
-5%, +10%
Nennstrom: 3A/1.5A
Frequenz: 47-63 Hz
dc Geraete
Nennspannung: 36-72 V
Nennstrom: 5A
Passport 4400 Series
ac appareils
Voltage d’Accès: 100-240 V∼
-5%, +10%
Courant d’Accès: 3A/1.5A
Fréquence: 47-63 Hz
dc appareils
Voltage d’Accès: 36-72 V
Courant d’Accès: 5A

iv
Notification of FCC Requirements
NOTE: This equipment has been tested and found to comply with the limits for a Class A digital device, pursuant
toPart15oftheFCCRules.Theselimitsaredesignedtoprovidereasonableprotectionagainstharmfulinterference
when the equipment is operated in a commercial environment. This equipment generates, uses, and can radiate
radiofrequencyenergyand,ifnotinstalledandusedinaccordancewiththeinstructionmanual,maycauseharmful
interference to radio communications. Operation of this equipment ina residential area is likely to cause harmful
interference in which case the user will be required to correct the interference at his own expense.
Changes or modifications to this product, that could increase the amount of Radio Frequency Emissions from this
product, without the expressed written approval of Nortel/Micom could cause the product and the user to violate
the FCC’s Rules and Regulations, thus requiring the product to be turned off or disconnected.
If this unit is used on a DTE which requires use of shielded cables for compliance with FCC Part 15, then use of a
filtered pin connector may be required to maintain FCC compliance. See the Installation section for specific appli-
cations.
Notification of Canadian Requirements
This digital apparatus does not exceed the Class A limits for radio noise emissions from digital apparatus as set
out in the Radio Interference Regulations of the Government of Canada Department of Industry.
Leprésentappareilnumériquen’émetpasdebruitsradioélectriquesdépassantleslimitesapplicablesauxappareils
numériques de classe A prescrites dans le règlement sur le brouillage radioélectrique édicté par le Ministère des
Industry du Canada.
United Kingdom Requirement: Interconnection of Ports Warning
Interconnection directly, or by way of other apparatus, of ports marked “SAFETY WARNING. See instructions for
use”, with ports marked or not so marked may produce hazardous conditions on the network. The advice of a
competentengineermustbeobtainedbeforesuchaconnectionismade.Noneoftheportsprovideisolationsufficient
to satisfy the relevant parts of BS 6301. Apparatus connected to the ports, must either have been approved to the
relevant parts of BS 6301 or to have been previously evaluated against BS 6301 British Telecom Technical Guides
2 or 26, and given permission to attach. Other usage will invalidate any approval given to this apparatus.
Any or all of the ports on the following modules may be configured as non-network ports:
•Base Module: Multiple Configuration Ports
•Up to 4 Voice Modules: Up to 2 Ports
•Legacy Data Module (LDM) and Legacy Data Expansion Modules (LEM)
•High Speed Data Modules (HDM): 4 or 8 Ports

v
Contents
Who Should Read this Document . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1
Introduction — 1
Overview . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-2
Safety Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-4
Specifications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-5
Base Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-5
WAN Serial Interface Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-11
56kbps CSU/DSU Interface Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-11
T1 CSU/DSU Interface Module. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-12
ISDN S/T Interface Module. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-13
ISDN U Interface Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-13
High-speed Data Module (HDM). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-14
Legacy Data Module/Legacy Data Expansion Module (LDM/LEM) . . . . . . . . . . . . . . . . . . . . . 1-14
T1 Voice Module (TVM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-15
E1 Voice Module (EVM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-16
Analog Voice Modules (AVM, UAVM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-17
Installing the Passport 4400 — 2
Preparing the Site . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-1
Unpacking the 4400 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-3
Passport 4400 Rack Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-3
Powering Up an ac Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-5
Powering Up a dc Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-6
Verifying Operation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-7
Reset Switch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-8
Connecting the Ethernet Base Module — 3
Frame Relay DCE Serial Access Port (Port 1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-2
Management Port . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-4
Ethernet Access Ports . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-5
Interface Module Connectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-6

vi
Connecting the Expansion Modules — 4
High-speed Data Module (HDM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-1
Legacy Data Module (LDM) and Legacy Data Expansion Module (LEM) . . . . . . . . . . . . . . . . . . . 4-3
T1 Voice Module (TVM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-5
E1 Voice Module (EVM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-6
Analog Voice Module (AVM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-7
Universal Analog Voice Module (UAVM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-9
Use of Terminal Block. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-10
Ethernet Base Module and Interface Modules — 5
Interface Modules . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-2
WAN Serial Interface Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-3
56kbps CSU/DSU Interface Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-4
T1 CSU/DSU Interface Module. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-5
ISDN Interface Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-6
Installing Expansion (Data and Voice) Modules — 6
Safety Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-1
Notice of Electromagnetic Compatibility (EMC) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-1
Module Stacking Order . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-2
Determining the Logical Interface Module (LIM) Identifier . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-2
Setting the Switchbank . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-3
Stacking Connectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-4
Back Panel Grounding Clips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-4
Spacers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-5
Blank Back Panels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-5
Installing an Expansion Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-6
Data Modules — 7
High-speed Data Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7-1
Low-speed Data Services Modules . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7-3
Connectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7-4

vii
Analog Voice Modules — 8
Universal Analog Voice Module (UAVM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8-1
Removing an Interface Module. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8-3
Inserting an Interface Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8-4
Interface Modules . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8-5
Analog Voice Module (AVM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8-13
Strapping. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8-14
T1/E1 and Digital Voice Modules — 9
T1 and E1 Voice Modules . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9-1
Strapping. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9-4
Digital Voice Expansion Module (DVEM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9-6
Digital Voice Module (DVM) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9-8
Installing Digital Voice Modules . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9-8
Power Supplies — 10
dc Power Supplies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10-1
Chassis types . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10-2
Three-slot Chassis (model 4430) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10-2
Five-slot Chassis (model 4450) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10-3
Five-slot Chassis with Redundant Power Supply (model 4450R). . . . . . . . . . . . . . . . . . . . . . . 10-4
Configuring the Power Supplies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10-5
Indicators — 11
Ethernet Base Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-1
T1/E1 Voice Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-2
Digital Voice Channel Status Indicators . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-2
T1/E1 Status Indicators. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-3
Digital Voice Expansion Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-5
Analog Voice Module and Universal Analog Voice Module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-6
Cable Diagram Pin Assignments A

viii

About this document-1
About this document
This document contains detailed information about the hardware components
that make up the Passport 4400 device. It describes the 3- and 5-slot chassis, the
ethernet base card, and all optional modules. Cabling information is included, as
is a discussion of system indicators and warning signals.
Who Should Read this Document
This document is intended for anyone responsible for installing and upgrading
Passport 4400 units and their hardware components.

Hardware Installation ManualAbout this document
About this document-2

1-1
Introduction 1
Passport 4400 devices are multimedia, frame relay access devices deployed as an
overlay to an existing Passport frame relay network. In this configuration,
Passport4400unitsformdistinctnetworksinwhichseparateunitscommunicate
using switched virtual circuits (SVCs) provided by the Passport backbone. This
arrangement allows small branch sites to consolidate multimedia traffic (such as
voice and LAN) over a single low-speed network link (operating at speeds such
as 56 or 64 kbps) and pass traffic through regional concentration sites served by
Passport.
Once deployed and provisioned, Passport 4400 units provide the following
services:
• voice, fax, and modem services via four different voice modules
• LAN services such as bridging and routing IP and IPX protocols
• Frame Relay DCE services.
In this manual, the Passport 4400 unit may be referred to as the 4400.

IntroductionPassport 4400 Hardware Installation Manual
1-2
Figure 1-1. Passport 4400 Models
Overview
The mix of hardware and functions in each Passport 4400 unit depends on the
application and site requirements. The major hardware components of the 4400
are described in this section. The 4400 consists of the following hardware
components:
• 3- or 5-slot chassis.
Model 3e
Model 5e
Model 5eR with Redundant Power Supply

Introduction Passport 4400 Hardware Installation Manual
1-3
Passport 4400 units are available for use with either ac or dc current, and a
redundant power supply option is available on the 5-slot models. Passport 4400
units are available in the following configurations:
• 4430ac, 3-slot, Ethernet interface, ac power
• 4450ac, 5-slot, Ethernet interface, ac power
• 4450dc, 5-slot, Ethernet interface, dc power
• 4450acR, 5-slot, Ethernet interface, ac power with redundant power
supply
• 4450dcR, 5-slot, Ethernet interface, dc power with redundant power
supply.
The chassis houses the modules that provide the various access services offered
by the 4400. The number of slots indicates the maximum number of modules,
including the base module, that can be supported by each unit.
Ethernet Base Module
The Ethernet Base Module performs central processing functions for the 4400.
This module must be present in the lowest slot in the unit for any of the other
modules to function.
The Ethernet Base Module includes the following:
• processor and memory
• serial access port
• management port
• AUI and 10BaseT Ethernet interfaces
• optional plug-in interface modules.
Data Modules
The Passport 4400 supports two types of data modules:
• High-speed Data Module
• Low-Speed Data Services Modules.
TheHigh-speedDataModule(HDM)providesadditionalportcapability,identical
to Port 1 on the Ethernet Base Module. The module supports RS-232, V.35, V.36,
and X.21 interfaces, determined by the cable used. The HDM can support both
DTE and DCE modes.

IntroductionPassport 4400 Hardware Installation Manual
1-4
Low-Speed Data Services Modules include the Legacy Data Module (LDM) and
the Legacy Data Expansion Module (LEM). The LDM and LEM provide legacy
protocolfor branch sites connected toa Passportonlynetwork.TheseincludeFR,
X.25, ITI, tr, SNA, SDLC, DTDS, HTDS. The LDM provides six legacy services
ports; the LEM provides an additional eight ports.
Analog Voice Modules
Two types of analog voice modules are available to provide analog voice support
for the Passport 4400:
• Analog Voice Module (AVM)
• Universal Analog Voice Module (UAVM).
BothmodulessupportForeignExchangeStation (FXS), ForeignExchangeOffice
(FXO), and Ear and Mouth (E&M) connections.
Digital Voice Modules
ThePassport4400unitsupportstheT1VoiceModule(TVM)andE1VoiceModule
(EVM) with digital voice connections. One Digital Voice Module (DVM) must be
inserted in the TVM or EVM for each digital voice channel required. To provide
full T1 or E1 support, the Digital Voice Expansion Modules (DVEM) provide
additional slots for DVMs as required.
Safety Information
Underwriters Laboratories, Inc. (UL), the Canadian Standards Association
(CSA), and TÜV for Germany request that the following statements of warning
be made in three languages to help in the safe operation of the unit.
Caution
:
!(English text UL/CSA, German text TUV, French text CSA)
Access to the interior of this unit shall be made only by a
qualified technician or Northern Telecom trained personnel.
Connection to the network is to be disconnected before the
main plug is removed.
Der Zugang ins Innere des Gerätes ist nur einem qualifizierten
Techniker gestattet.
Ehe der Netzstecker aus der Steckdose gezogen wird, müssen
sämtliche äusserliche Verbindungen vom Gerät getrennt
werden.
Ouverture de cet appareil est permise par un technicien
autorisé seulement.
Avantdedébrancherlaprise decourant, assurerque toutes les
connexions externes ont été déconnecté de l’appareil.

Introduction Passport 4400 Hardware Installation Manual
1-5
When working inside the unit, be sure to take all precautions against
electrostatic discharge:
• Wear a grounding strap to protect the equipment while the unit is open.
• To discharge any buildup of static electricity, touch any metal part of the
unit before handling any module.
• Avoid working on carpet.
Specifications
Note: Model numbers listed with a lowercase "x" indicate a revision
number for the selected model. For instance, model number
NTAU03xx represents all model numbers that begin with
NTAU03.
Base Unit
Physical Dimensions
3-slot Unit
Width 18 inches (45.7 cm)
Height 5 inches (12.7 cm)
Depth 12.75 inches (32.4 cm)
5-slot Unit
Width 18 inches (45.7 cm)
Height 7.75 inches (19.7 cm)
Depth 12.75 inches (32.4 cm)
5-slot Unit with Redundant Power Supply
Width 18 inches (45.7 cm)
Height 8.25 inches (21.0 cm)
Depth 12.75 inches (32.4 cm)
Warning
:
!WARNUNG, AVERTISSEMENT
Remove power plug from the power socket, or disconnect dc
power, before performing any service work on the unit.
Vor öffnen des Gerätes, muss der Netzstecker aus der
Steckdose gezogen werden.
Débrancher la prise de courant avant d’entreprendre aucun
travail de réparation de l’appareil.

IntroductionPassport 4400 Hardware Installation Manual
1-6
Operating Environment
Temperature
Operating 32 to 122°F (0 to 50°C)
Storage -40 to 158°F (-40 to 70°C)
Relative Humidity
Operating 10-90% non-condensing
Storage 0-95% non-condenseing
Power Requirements
ac: 100-240 volts ac, -5%, +10%
43-63 Hz, 160 Watts maximum
(model 4430ac – 135 Watts max.)
dc: 36-72 volts dc
@ 3A maximum
Agency Compliances
Safety
UL 1950
CSA Standard C22.2 No. 950
IEC 950
TUV: EN60950
EN41003
BABT 340 (where applicable)
Electromagnetic Compatibility
FCC Part 15, Level A (T1 only)
C.R.C., c, 1374 (T1 only)
EN 55022
CISPR 22, class A
IEC 801-2:1991/prEN55024-2:1992, 3KV, CD, 8KV DA
IEC 801-3:1984/prEN55024-3:1991, 3 V/m
IEC 801-3:1988/prEN55024-4:1993, 0.5KV Signal, 1KV Power
EN 60555
EU Declaration of Conformity
Safety: Directive: 73/23/EEC
EMC: Directive 89/336/EEC

Introduction Passport 4400 Hardware Installation Manual
1-7
Telecommunications Requirements
The following information applies only to Passport 4400 units that are connected
to a telephone network.
Repair Instructions
If you experience trouble with this equipment, follow this procedure:
1. Determine whether the problem is your data terminal equipment. If you
have another data terminal equipment, connect it in place of the
inoperative unit to see if the data terminal equipment or the line is at fault.
2. If you find the problem is in your Nortel equipment, contact your customer
service representative.
The telephone company may ask you to disconnect this equipment from the
network until the problem has been corrected or you are sure that the equipment
is not malfunctioning.
User’s Responsibility
You must supply the following information upon request:
• Whether the notification is about a connection or disconnection
• The manufacturer of the device – Northern Telecom
• Model number of the device:
— Passport 4430ac: QMY922x
— Passport 4450ac: QMY923x
— Passport 4450acR: QMY924x
— Passport 4450dc: QMY926x
— Passport 4450dcR: QMY927x
• FCC Part 68 (U.S.A. T1) – see label on card for registration number
• DOC CS-03 (Canada) – see label on card for registration number
• Jack to be used – RJ48C or RJ11.
Warning
:
!Do not attempt to repair the unit. Attempting to repair the unit
may cause injury, and may also damage equipment on the
telephone network. Attempts to repair the unit are violations of
FCC rules. Repair to this equipment can only be made by the
manufacturer, and its authorized agents, and by others who
may be authorized by the FCC.

IntroductionPassport 4400 Hardware Installation Manual
1-8
In addition to the above information you will be required to supply the following
supplementalinformation if your system is an XD,DD, DE or OTrequiring three
or more C.O. lines:
• Sequence in which the trunks are to be connected
• Facility interface codes by position
• Service order codes by position.
Note: The FCC registration label includes the ringer equivalence,
because at the time FCC Part 68 was established, digital
systems without ringing had not been established. Even though
the ringer equivalence must appear on the label, it is
inconsequential in the case of digital communications.
Connection of this unit to the nationwide telecommunications network must be
through a standard network interface jack (RJ48C or RJ11) which must be
ordered from the telephone company.
Telephone Company Rights and Responsibilities
If your data terminal equipment causes harm to the telephone network the
telephone company may discontinue your service temporarily. If possible, they
willnotifyyouinadvance.Butifadvancenoticeisnotpractical,youwillbenotified
assoon as possible.Youwill be given the opportunity to correct the situation, and
you will be informed of your right to file a complaint with the regulatory agency.
Yourtelephonecompanymaymakechangesinitsfacilities,equipment,operation,
or procedures that could affect the proper functioning of your data communi-
cations equipment. If they do, you will be notified in advance to give you an
opportunity to maintain uninterrupted service.
FCC Requirements
YoumustnotifythetelephonecompanywheneverthePassport4400isconnected
to or disconnected from a telephone company line. This equipment complies with
the Federal Communications Commission (FCC) Rules. On the back of this
equipmentisalabelthatcontains,amongotherinformation,theFCCregistration
number.
Equipment Attachment Limitations for Operation in Canada
CP-01, Part I, Section 10.1
NOTICE:TheCanadianDepartmentofCommunicationslabelidentifiescertified
equipment. This certification means that the equipment meets certain telecom-
munications network protective, operational and safety requirements. The
Department does not guarantee the equipment will operate to the user’s
satisfaction.
Before installing this equipment, users should ensure that it is permissible to be
connected to the facilities of the local telecommunications company. The
equipment must also be installed using an acceptable method of connection. In

Introduction Passport 4400 Hardware Installation Manual
1-9
some cases, the company’s inside wiring associated with a single line individual
service may be extended by means of a certified connector assembly (telephone
extension cord). The customer should be aware that compliance with the above
conditions may not prevent degradation of service in some situations.
Repairs to certified equipment should be made by an authorized Canadian
maintenance facility designated by the supplier. Any repairs or alterations made
by the user to this equipment, or equipment malfunctions, may give the telecom-
munications company cause to request the user to disconnect the equipment.
Users should ensure for their own protection that the electrical ground
connections of the power utility, telephone lines and internal metallic water pipe
system, if present, are connected together. This precaution may be particularly
important in rural areas.
CP-01, Part I, Section 10.2
NOTICE: The Load Number (LN) assigned to each terminal device denotes the
percentage of the total load to be connected to a telephone loop which is used by
the device, to prevent overloading. The termination on a loop may consist of any
combination of devices subject only to the requirement that the total of the Load
Numbers of all the devices does not exceed 100.
Affidavit Requirements for Connections to Digital Services (US)
• An affidavit must be served to the telephone company whenever digital
terminalequipmentwithoutencoded analogcontentandbillingprotection
is used to transmit digital signals containing encoded analog content
which are intended for eventual conversion into voice band analog signals
and retransmitted on the network.
• The affidavit shall affirm that either no encoded analog content or billing
information is being transmitted or that the out put of the device meets
Part 68 encoded analog content or billing protection specification.
• The end user will be responsible for filing an affidavit with the local
exchange carrier when connecting unprotected CPE to 1.544 Mbps or to
Subrate digital services.
• Until such time as subrate terminal equipment is registered for voice
applications, the affidavit requirement for subrate services is waived.
Caution
:
!Users should not attempt to make such connections themselves,
but should contact the appropriate electric inspection authority, or
electrician, as appropriate.

IntroductionPassport 4400 Hardware Installation Manual
1
-10
AFFIDAVIT FOR CONNECTION OF CUSTOMER PREMISES EQUIPMENT TO 1.544 MBPS AND/OR
SUBRATE DIGITAL SERVICES
For the work to be performed in the certified territory of ___________________(Telco Name),
State of____________________, county of________________________________,
I,_____________________(name), _____________________________________(business
address)________________________(telephone number) being duly sworn, state:
I have responsibility for the operation and maintenance of the terminal equipment to be
connected to ________________________________________________1.544 Mbps and/or
_____________________Subrate digital services. The terminal equipment to be connected
complies with Part 68 of the FCC rules except for the encoded analog content and billing
protection specifications with respect to analog content and billing protection:
( ) I attest that all operations associated with the establishment, maintenance, and adjustment of
the digital CPE with respect to encoded analog content and encoded billing protection
information continuously complies with Part 68 of the FCC Rules and Regulations.
( ) The digital CPE does not transmit digital signal containing encoded analog content or billing
information which is intended to be decoded within the telecommunications network.
( ) The encoded analog content and billing protection is factory set and is not under the control
of the customer.
I attest that the operator(s)/maintainer(s) of the digital CPE responsible for the establishment,
maintenance, and adjustment of the encoded analog content and billing information has (have)
been trained to perform these functions by successfully having completed one of the following
(check appropriate blocks):
( )_____a. A training course provided by the manufacturer/grantee of the equipment used to
encode analog signals; or
( )_____b. A training course provided by the customer or authorized representative using
training materials and instructions provided by the manufacturer/grantee of the equipment used
to encode analog signals; or
( )_____c. An independent training course (e.g., trade school or technical institution) recognized
by the manufacturer/grantee of the equipment used to encode analog signal; or
( )_____d. In lieu of the preceding training requirements, the operation(s)/maintainer(s) is (are)
under the control of a supervisor trained in accordance with _____(circle one) above.
I agree to provide____________________(telco’s name) with proper documentation to
demonstrate compliance with the information as provided in the preceding paragraph, if so
requested.
____________________(signature)
____________________(title)
____________________(date)
Subscribed and Sworn to before me this _____day of_________,(year)
______________________________
Notary Public
My commission expires: