Viking F20024B User manual

Viking Range Corporation
designer series
built-in electric wall ovens
Use and Care Manual
Specifications subject to change without notice
For more product information, call 1-888-VIKING1 (845-4641), or visit the
Viking web site at http://www.vikingrange.com
F20024B (MM0703VR
DDEESSIIGGNNEERRSSEERRIIEESS
BBUUIILLTT--IINNEELLEECCTTRRIICCOOVVEENNSSWWAARRRRAANNTTYY
OONNEEYYEEAARRFFUULLLLWWAARRRRAANNTTYY
Built-in electric ovens and all of their component parts and accessories, except as detailed below*, are warranted to be
free from defective materials or workmanship in normal household use for a period of twelve (12) months from the date
of original retail purchase. Viking Range Corporation, warrantor, agrees to repair or replace, at its option, any part which
fails or is found to be defective during the warranty period.
*Glass (including light bulbs), painted and decorative items are warranted to be free from defective materials or
workmanship for a period of ninety (90) days from the date of original retail purchase. ANY DEFECTS MUST BE
REPORTED TO THE SELLING DEALER WITHIN NINETY (90) DAYS FROM DATE OF ORIGINAL RETAIL PURCHASE.
Viking Range Corporation uses the most up-to-date processes and best materials available to produce all color finishes.
However, slight color variation may be noticed because of the inherent differences in painted parts and porcelain parts as
well as differences in kitchen lighting, product locations, and other factors.
FFIIVVEEYYEEAARRLLIIMMIITTEEDDWWAARRRRAANNTTYY
Any bake element, broil element, or convection cook element which fails due to defective materials or workmanship in
normal household use during the second through fifth year from the date of original retail purchase will be repaired or
replaced, free of charge for the part itself, with the owner paying all other costs, including labor.
TTEENNYYEEAARRLLIIMMIITTEEDDWWAARRRRAANNTTYY
Any porcelain oven or porcelain inner door panel which rusts through due to defective materials or workmanship in
normal household use during the second through the tenth year from the date of original retail purchase will be repaired
or replaced, free of charge for the part itself, with the owner paying all other costs, including labor.
This warranty extends to the original purchaser of the product warranted hereunder and to each transferee owner of the
product during the term of the warranty.
This warranty shall apply to products purchased and located in the United States and Canada. Products must be
purchased in the country where service is requested. Warranty labor shall be performed by an authorized Viking Range
Corporation service agency or representative. Warranty shall not apply to damage resulting from abuse, accident,
natural disaster, loss of electrical power to the product for any reason, alteration, outdoor use, improper installation,
improper operation, or repair or service of the product by anyone other than an authorized Viking Range Corporation
service agency or representative. This warranty does not apply to commercial usage. Warrantor is not responsible for
consequential or incidental damage whether arising out of breach of warranty, breach of contract, or otherwise. Some
jurisdictions do not allow the exclusion or limitation of incidental of consequential damages, so the above limitation or
exclusion may not apply to you.
Owner shall be responsible for proper installation, providing normal care and maintenance, providing proof of purchase
upon request, and making the appliance reasonably accessible for service. If the product or one of its component parts
contains a defect or malfunction during the warranty period, after a reasonable number of attempts by the warrantor to
remedy the defects or malfunctions, the owner is entitled to either a refund or replacement of the product or its
component part or parts. Warrantor’s liability on any claim of any kind, with respect to the goods or services covered
hereunder, shall in no case exceed the price of the goods or service or part thereof which gives rise to the claim.
WARRANTY SERVICE:Under the terms of this warranty, service must be performed by a factory authorized Viking
Range Corporation service agent or representative. Service will be provided during normal business hours, and labor
performed at overtime or premium rates shall not be covered by this warranty. To obtain warranty service, contact the
dealer from whom the product was purchased, an authorized Viking Range Corporation service agent, or Viking Range
Corporation. Provide model and serial number and date of original purchase. For the name of your nearest authorized
Viking Range Corporation service agency, call the dealer from whom the product was purchased or Viking Range
Corporation. IMPORTANT: Retain proof of original purchase to establish warranty period.
The return of the Owner Registration Card is not a condition of warranty coverage. You should, however, return the
Owner Registration Card so that Viking Range Corporation can contact you should any question of safety arise which
could affect you.
Any implied warranties of merchantability and fitness applicable to the above described bake element, broil element,
convection cook element, porcelain oven, or porcelain inner door panel are limited in duration to the period of coverage
of the applicable express written limited warranties set forth above. Some jurisdictions do not allow limitations on how
long an implied warranty lasts, so the above limitation may not apply to you. This warranty gives you specific legal
rights, and you may also have other rights which may vary from jurisdiction to jurisdiction.
VIKING RANGE CORPORATION
111 Front Street
Greenwood, Mississippi (MS) 38930 USA • [phone]

3
IImmppoorrttaannttSSaaffeettyyIInnssttrruuccttiioonnss
RReeaaddbbeeffoorreeooppeerraattiinnggyyoouurroovveenn
1. Use this appliance only for its intended use as described in this
manual. Never use your appliance for warming or heating the room.
This is based on safety considerations.
2. Your unit should be installed by a qualified technician. The appliance
must be installed and electrically grounded according to local codes.
3. Do not attempt to repair or replace any part of this appliance unless
specifically recommended in this manual. All servicing should be
referred to a qualified technician. Warranty service must be
performed by an authorized service agency.
4. Children should not be left alone in the kitchen while the oven is in
use. CAUTION: Do not store items of interest to children over the
unit. Children climbing to reach items could be seriously injured.
5. GREASE - Grease is flammable and should be handled carefully. Do
not use water on grease fires. Flaming grease outside of utensil can
be extinguished with baking soda or, if available, a multipurpose dry
chemical or foam type extinguisher. Let fat cool before attempting to
handle it. Do not allow grease to collect around the oven or in vents.
Wipe up spillovers immediately.
6. Loose-fitting or hanging garments should never be worn while using
the appliance. Do not drape towels or materials on oven door
handles. These items could ignite and cause burns.
7. Use only dry potholders. Moist or damp pot holders on hot surfaces
may result in burns from steam. Do not let pot holder touch hot
surface areas. Do not use a towel or other bulky cloth.
8. Keep area clean and free from combustible material, gasoline, and
other flammable liquids. Never use your oven as a storage space.
Combustible items (paper, plastic, etc.) may ignite and metallic items
may become hot and cause burns.
2
CCoonnggrraattuullaattiioonnss. . .
Your purchase of this product attests to the importance you place
upon the quality and performance of the major appliances you use. With
minimal care, as outlined in this guide, this product is designed to provide
you with years of dependable service. Please take the few minutes
necessary to learn the proper and efficient use and care of this quality
product.
We appreciate your choosing a Viking Range Corporation
product, and hope that you will again select our products for your other
major appliance needs.
Table of Contents
Warnings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2
Important Safety Instructions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3
Basic Functions of Your Oven . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .6
Using Your Oven . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8
Electronic Timing Center (Digital Display) . . . . . . . . . . . . . . . . . . .8
Electronic Timing Center (Analog Clock w/Digital Display) . . . . . .12
Two Element Baking/Convection Baking/Convection Cooking . . . . .18
Conventional Broiling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .31
Convection Broiling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .31
Convection Dehydrate . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34
Convection Defrost . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34
Cleaning and Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34
Self-Clean Cycle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .36
Replacing Interior Lights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37
Power Failure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38
Service Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39
Warranty . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Rear Cover
WWAARRNNIINNGG
If the information in this manual is not followed exactly,
a fire or explosion may result causing property damage,
personal injury or death.

5
BBuuiilltt--IInnEElleeccttrriiccOOvveennFFeeaattuurreess
8-pASS BROIL
ELEMENT
oVEN
LIGHT
oVEN
LIGHT
TRUCONVECtm
ELEMENT
(BEHIND BAFFLE)
OVEN
RACKS
(3/UPPER
OVEN;
2/LOWER
OVEN
BAKE
ELEMENT
MODEL/SERIAL
NUMBER
PLATE (BEHIND
DOOR)
sELF-CLEAN
NON-
CONVECTION
LOWER OVEN
4
9. Do not heat unopened food containers; buildup of pressure may cause
the container to explode and result in injury.
10. Always position oven racks in desired location while oven is cool. If
rack must be moved while oven is hot, do not let potholder contact
hot heating element in oven.
11. Use care when opening oven door. Let hot air or steam escape
before removing or replacing food. Hot air or steam can cause burns
to hands, face and/or eyes.
12. Keep oven vents unobstructed. The oven vent is located at the front
of the oven and vents into the room.
13. Do not clean door gasket. It is essential for a good tight seal. Care
should be taken not to rub, damage, or move the gasket.
14. No commercial oven cleaner or oven liner protective coating such as
aluminum foil should be used in or around any part of the oven.
Improper oven liners may result in a risk of electric shock or fire.
Keep oven free from grease buildup.
15. Before self-cleaning the oven, remove broiler pan, broiler grid, oven
racks, rack supports, and other utensils. Do not use your oven to
clean other parts. A fan noise should be heard during the cleaning
cycle If not, call service before self-cleaning again.
16. DO NOT TOUCH HEATING ELEMENTS OR INTERIOR SURFACES
OF OVEN. Heating elements may be hot even though they are dark
in color. Interior surfaces of an oven become hot enough to cause
burns. During and after use, do not touch, or let clothing or other
flammable materials contact heating elements or interior surfaces of
oven until they have had sufficient time to cool. Other surfaces of the
oven may become hot enough to cause burns, such as the oven vent
opening, the surface near the vent opening, and the oven door
window.
--SSAAVVEETTHHEESSEEIINNSSTTRRUUCCTTIIOONNSS--

7
For "slow" broiling, allow about 4 inches between
the top surface of the food and the broil element.
"Slow" broiling is best for chicken and ham in
CCoonnvveeccttiioonnBBrrooiillorder to broil food without over-browning it.
((uuppppeerroovveennoonnllyy))
Exactly the same as regular broiling with
additional benefit of air circulation by the
motorized fan in the rear of the oven. The cool air
is quickly replaced-improving the already high
performance of the broil element. Especially
useful for broiling thick cuts of meat.
With the selector set to convection cook and the
temperature control on 150 F, warm air is
circulated by a motorized fan in the rear of the
oven. Over a period of time, the water is
removed from the food by evaporation. Removal
of water inhibits growth of microorganisms and
retards the activity of enzymes. It is important to
remember that dehydration does not improve the
quality, so only fresh, top-quality foods should be
used.
With the selector set to convection cook and the
temperature control off, air is circulated by a
motorized fan in the rear of the oven. The fan
accelerates natural defrosting of the food without
heat. To avoid sickness and food waste, do not
allow defrosted food to remain in the oven for
more than two hours.
This oven features a pyrolytic self-cleaning cycle.
During this cycle, the oven reaches elevated
temperatures in order to burn off soils and deposits.
An integral smoke eliminator reduces odors
associated with the soil burn-off. A powder ash
residue is left in the bottom of the oven after
completion of the self-clean cycle. When the oven
has cooled, remove any ash from oven surfaces with
a damp sponge or cloth.
CCoonnvveeccttiioonnDDeehhyyddrraattee
((uuppppeerroovveennoonnllyy))
CCoonnvveeccttiioonnDDeeffrroosstt
((uuppppeerroovveennoonnllyy))
SSeellff--CClleeaann
6
BBaassiiccFFuunnccttiioonnssooffYYoouurrOOvveenn
TTwwoo--EElleemmeennttBBaakkeeFull power heat is radiated from the bake element
in the bottom of the oven cavity, and
supplemental heat is radiated from the broil
element. This function is recommended for single
rack baking and roasting.
Exactly the same as regular baking with the
additional benefit of air circulation. The heated air
is circulated by the motorized fan in the rear of the
oven. It provides more even heat distribution
throughout the oven cavity for all uses. Multiple
rack use is possible for the largest baking jobs.
When roasting, cool air is quickly replaced-searing
meats on the outside and retaining more juices
and natural flavor on the inside with less shrinkage.
The rear element only operates at full power.
There is no direct heat from the bottom or top
elements. Air in the oven cavity is circulated by
the fan for even heating. Use this setting for
foods which require gentle cooking such as
pastries, souffles, yeast breads, quick breads and
cakes. Use this function for single rack baking,
multiple rack baking, roasting, and preparation of
complete meals.
In Maxi-Broil heat is radiated from both broil
elements, located in the top of the oven cavity, at
full power. Broiling speed is determined by the
distance between the foods and the broil
elements. For "fast" broiling, food may be as
close as 2 inches to the broil element or on the
top rack. "Fast" broiling is best for meats where
"rare to medium" doneness is desired. The Mini-
Broil setting is designed for "slow" broiling. Only
the center broil element operates for partial
power.
TTrruuCCoonnvveeccttmm
((uuppppeerroovveennoonnllyy))
BBrrooiill
CCoonnvveeccttiioonnBBaakkee
((uuppppeerroovveennoonnllyy))

9
The time-of-day can be changed by following steps 1 through 3. It cannot
be changed while there is a Bake Hours or Start Time cycle programmed
into the timer.
SSeettttiinnggtthheeMMIINN//SSEECCTTiimmeerr
The MIN/SEC Timer is designed for accurate timing and is ideal for baking
delicate items such as biscuits, cookies, and popovers, and for precise
broiling. The MIN/SEC timer can be used at the same time the Bake Hours
or Start Time functions are in use. It can be used for timing up to 24 hours.
When setting the Timer, the time displayed will increase in 1 minute
increments. When the Timer counts down to 1 minute, the timer alarm will
give two short beeps and the display changes from hours:minutes to
seconds only.
TToopprrooggrraammtthheeMMIINN//SSEECCTTiimmeerr
1. Press the MIN/SEC Timer button. The timer will display :00 and the
word timer will be displayed in the lower right corner.
2. Turn the Set Knob until the desired duration time is displayed.
The Timer is now programmed. The alarm will sound at the end of the
countdown. The program can be canceled anytime by setting the
remaining time to :00. To change back to the time-of-day, press the
CLOCK button. Notice that a small clock will be displayed in the upper
right corner to indicate that a program is in progress. The display will return
automatically to the MIN/SEC Timer after a few seconds.
TTiimmeerrAAllaarrmm
At the end of a MIN/SEC Timer program or Bake Hours program, the alarm
will consist of three beeps followed by two beeps every 10 seconds until
the MIN/SEC Timer button is pressed. Whenever a valid function key is
pressed or when a control function starts automatically, one beep will be
sounded. When an invalid function key is pressed, two beeps will be
sounded.
8
UUssiinnggYYoouurrOOvveenn
EElleeccttrroonniiccTTiimmiinnggCCeenntteerr((DDiiggiittaallDDiissppllaayy))
The Electronic Timing Center is used to program and control all timing
functions. Depending on the model, your unit will have a digital display or
an analog clock with digital display. If your unit has an analog clock, refer to
pages 13-16.
It has five display and programming modes that are activated by the four
push buttons and the Set Knob. Both the Bake Hours mode and the
MIN/SEC Timer mode can be used to time cooking periods. These
features can even be used at the same time when both ovens are in use.
However, only Bake Hours and Self-Cleaning modes shut the oven off
automatically when the timed program is over. For example, you can time
bake a casserole in the upper oven using the Bake Hours mode, while
broiling in the lower oven using the MIN/SEC Timer. One oven can also be
cleaned while timing foods in the other oven using the MIN/SEC Timer.
SSeettttiinnggtthheeTTiimmee--ooff--DDaayy
The time-of-day must be set before any other program can be used. When
your oven is first connected to the power in your home, the timer display
will show --:--. To program the time-of-day:
1. Press the CLOCK button. 12:00 will be displayed with the word set in
the upper right corner.
2. Turn the Set Knob until the correct time-of-day is displayed. AM and PM
are not indicated.
3. Press the CLOCK button again. The word set will disappear and the
correct time is now set into the timer.

11
SSeettttiinnggtthheeAAuuttoommaattiiccSSttaarrttTTiimmeeBBaakkeePPrrooggrraamm
The Bake Hours and Start Time modes of the Timer can be used to
automatically turn the oven on and off at a preselected time. The
Automatic Time Bake Program is ideal for foods with no danger of spoilage
during the time the oven is left off.
TToosseetttthheeAAuuttoommaattiiccTTiimmeeBBaakkeepprrooggrraamm
1. Turn the MANUAL/TIMED knob to TIMED, UPPER TIMED OR LOWER
TIMED position, depending upon the oven mode and oven being used.
2. Set the Oven Function Selector to the BAKE, CONVECTION BAKE, or
TruConvecTM position, depending upon the type of baking being used.
3. Program the Start Time by pressing the Start Time button and turning
the Set Knob until the desired Start Time is displayed. This is the time-
of-day you want the food to begin cooking.
4. Program the required baking time by pressing the Bake Hours button.
The words set and cook in the upper right corner. Turn the Set Knob
until the desired baking time is displayed in hours and minutes. The
word set will disappear and the word delay will remain in the display
indicating that the Bake Hours program has been set.
5. Set the Temperature Control Knob to the desired temperature.
When the specified start time is reached, the oven will automatically turn
on. The oven then bakes for the length of time programmed into the Bake
Hours mode, turn the oven off, and sounds the alarm. Setting the
remaining duration time to :00 cancels the automatic bake program.
10
SSeettttiinnggtthheeBBaakkeeHHoouurrssPPrrooggrraamm
The Bake Hours program is used of controlled timing of baked or roasted
foods. At the end of the timed cycle, the oven automatically turns off.
Times in the Bake Hours mode are displayed in hours and minutes, with a
setting from 1 minute to 11 hours 50 minutes, increasing in 1 minute
increments.
TToosseetttthheeBBaakkeeHHoouurrsspprrooggrraamm
1. Turn the MANUAL/TIMED knob to TIMED, UPPER TIMED OR LOWER
TIMED position, depending upon the oven mode and oven being used.
2. Set the Oven Function Selector to the BAKE, CONVECTION BAKE, or
TruConvecTM position, depending upon the type of baking being used.
3. Set the temperature Control knob to the desired temperature and allow
for preheating.
4. Press the Bake Hours button. The Timer will display :00 with the words
set and cook in the upper right corner.
5. Turn the Set Knob until the desired baking time is displayed in hours and
minutes. The word cook will remain in the display indicating that the
Bake Hours program has been set.
The Timer will automatically compute a stop time and enter it into the timer
memory. The alarm will sound three beeps followed by two beeps every 10
seconds until the Bake Hours button is pressed. The duration time can be
changed anytime during the cooking program by following steps 4 and 5.
Setting the remaining duration time to :00 cancels the Bake Hours program.
To return the Timer to the present time-of-day, press the CLOCK button. A
small clock will appear in the upper right corner indicating a Bake Hours
program has been set. The Timer will go back to the Bake Hours
automatically after a few seconds.

1312
TToopprrooggrraammtthheeMMIINN//SSEECCTTiimmeerr
1. Push and release the “timer” button.
2. Rotate “Set” knob until desired duration of time is displayed. Timer
starts seconds after “Set” knobs stops rotating. A tone indicates the
timer has started.
When the timer has one minute remaining, the timer will sound twice and
begin to countdown by seconds. A tone will sound three times indicating
the time is complete and twice every ten seconds after completion until
timer function is cleared.
NOTE: Press any function button to clear a completed cycle or function.
SSeettttiinnggtthheeBBaakkeeHHoouurrssPPrrooggrraamm
The Bake Hours program is used for controlled timing of baked or roasted
foods. At the end of the timed cycle, the oven automatically turns off.
TToosseetttthheeBBaakkeeHHoouurrsspprrooggrraamm
1. Turn the MANUAL/TIMED knob to TIMED, UPPER TIMED OR LOWER
TIMED position, depending upon the oven mode and oven being used.
2. Set the Oven Function Selector to the BAKE, CONVECTION BAKE, or
TruConvecTM position, depending upon the type of baking being used.
3. Set the temperature Control knob to the desired temperature and allow
for preheating.
4. Press and release the Bake Hours button. The Timer will display :00 with
the words set and cook in the upper right corner of the digital display.
5. Turn the Set Knob until the desired baking time is displayed in hours and
minutes. The cook time/remaining time and “Cook” will be displayed.
“Cook” will flash and the tone will sound three times when the time is
completed; oven will turn off. The tone will sound twice every ten seconds
after completion until timer function is cleared.
EElleeccttrroonniiccTTiimmiinnggCCeenntteerr((AAnnaallooggCClloocckkww//DDiiggiittaallDDiissppllaayy))
SSyynncchhrroonniizziinnggtthheeaannaallooggaannddddiiggiittaallcclloocckkss
Synchronizing the analog and digital clocks
1. Press the “timer” and “start time” buttons simultaneously.
2. Turn the set knob to move the hands on the analog clock to any time
setting.
3. After five seconds the display will go blank. Press the timer button and
using the set knob, set the digital time to the exact time on the analog
clock.
This will synchronize the two clocks. You can now set the time of day.
SSeettttiinnggtthheeTTiimmee--ooff--DDaayy
The time-of-day must be set before any other program can be used. When
your oven is first connected to the power in your home, the digital display
will show 00:00. To program the time-of-day:
1. Push and hold the “timer” and “bake hours” button at the same time.
2. Turn the “Set” knob until correct time is displayed on the digital clock.
3. Release “timer” and “bake hours” button
The analog clock will automatically set after the digital time is set.
SSeettttiinnggtthheeMMIINN//SSEECCTTiimmeerr
The MIN/SEC Timer is designed for accurate timing and is ideal for baking
delicate items such as biscuits, cookies, and popovers, and for precise
broiling. The MIN/SEC timer can be used at the same time the Bake Hours
or Start Time functions are in use. It can be used for timing up to 24 hours.
timer bake
hours probe
temp.
Set start time
00:00

1514
PPrroobbeeffuunnccttiioonn
The meat probe takes the guesswork our of roasting by cooking foods to
the ideal internal temperature. The “probe temp.” setting is used to
automatically turn the oven off when the internal temperature of the meat
being roasted is reached.
TToosseetttthheeaauuttoommaattiiccpprroobbeeffuunnccttiioonn
1. Insert the probe into the meat and slide into oven.
2. Plug the probe into the outlet located on left interior wall of the oven
and close the oven door.
3. Press and release the “probe temp.” button.
4. Turn the “Set” knob to the desired internal temperature. “Probe” and
the desired internal temperature will be displayed to the lower right of
the analog clock. NOTE: It is recommended to set the internal
temperature about 10 degrees lower than actual desired internal
temperature. The meat will continue to cook when removed from the
oven and will reache desired internal temperature while “standing”.
“Probe” flashes, tone sounds three times, and oven shuts off when desired
temperature is reached. The tone will sound twice every ten seconds after
completion until probe function is closed.
SSeettttiinnggtthheeAAuuttoommaattiiccSSttaarrttTTiimmeeBBaakkeePPrrooggrraamm
The “bake hours” and “start time” modes of the Timer can be used to
automatically turn the oven on and off at a preselected time. The
Automatic Time Bake Program is ideal for foods with no danger of spoilage
during the time the oven is left off.
TToosseetttthheeAAuuttoommaattiiccTTiimmeeBBaakkeepprrooggrraamm
1. Turn the MANUAL/TIMED knob to TIMED, UPPER TIMED OR LOWER
TIMED position, depending upon the oven mode and oven being used.
2. Set the Oven Function Selector to the BAKE, CONVECTION BAKE, or
TruConvecTM position, depending upon the type of baking being used.
3. Press and release “start time”. Turn the “Set” knob to desires start time.
4. Press and release “bake hours” button. Turn the “Set” knob until
desired duration of cooking time is reached. “Delay” will be displayed
in the upper left corner of the digital display during the delay cycle.
Once the bake cycle begins, the cook time/remaining time and “Cook”
will be displayed.
When the specified start time is reached, the oven will automatically turn
on. The oven then bakes for the length of time programmed into the Bake
Hours mode, turn the oven off, and sounds the alarm. “Cook” will flash
and the tone will sound three times when the time is completed; oven will
turn off. The tone will sound twice every ten seconds after completion until
timer function is cleared.
NOTE: If the “bake hours” button is not pressed within ten seconds of
setting the “start time”, the user will automatically be prompted to enter
the “bake hours”. A tone will sound twice every five seconds until the
“bake hours” is entered.

17
•MAXI-BROIL
The top element operates at full power. Use this setting for broiling small
and average cuts of meats.
•MINI-BROIL
Only the center broil element operates for partial power. This setting is
designed for small amounts of food and "slow" broiling.
•CONVECTION BROIL (upper oven only)
The top element operates at full power. Air in the oven cavity is circulated
by the fan for even heating. Use this setting for broiling thick cuts of
meats.
•SELF-CLEAN
The self-clean cycle is designed to eliminate the need for scrubbing and
scouring food baked onto the oven interior. The self-clean cycle heats
these soils to a high temperature in which the baked on food is burned off.
TTEEMMPPEERRAATTUURREECCOONNTTRROOLL
Each oven has a separate temperature control dial. The controls can be set
at any temperature from 150oF to 550oF. There are separate settings for
broiling and self-cleaning. Always be sure the controls are in the OFF
position when the ovens are not in use.
IINNTTEERRIIOORROOVVEENNLLIIGGHHTTCCOONNTTRROOLL
The upper and lower ovens have interior oven lights that are controlled by
separate switches on the control panel. Push the switch to turn the interior
oven lights on and off.
16
WWAARRNNIINNGG: To avoid sickness and food waste when using automatic
time baking:
-Do not use foods that will spoil while waiting for cooking to start, such as
dishes with milk or eggs, cream soups, custards, fish, pork, poultry, or foods
with stuffing.
-Any food that has to wait for cooking to start should be very cold or
frozen before it is placed in the oven.
-Do not use foods containing baking powder or yeast when automatic
time baking. They will not rise properly.
-Do not allow food to remain in the oven for more than two hours after the
end of the cooking cycle.
OOVVEENNFFUUNNCCTTIIOONNSSEELLEECCTTOORR
Each oven has a separate oven function selector. There are seven
settings on each selector.
•BAKE:
The bottom element operates at full power, and the top broil element
operates at supplemental power. Use this setting for baking, roasting, and
casseroles.
•CONVECTION BAKE (upper oven only)
The bottom element operates at full power, and the top broil element
operates at supplemental power. Air in the oven cavity is circulated by the
fan for even heating. Use this setting for baking and roasting.
•TruConvectm (upper oven only)
The rear element only operates at full power whenever heating. There is no
direct heat from the top or bottom elements. Air in the oven cavity is
circulated by the fan for even heating. Use this setting for foods which
require gentle cooking such as pastries or soufflés, and for baking yeast
breads and cakes. This setting is also recommended when baking large
quantities of baked goods at one time.

19
RRaacckkPPoossiittiioonnss
Each oven is equipped with three tilt-proof racks. All ovens have six rack
positions. Position 6 is the farthest from the oven bottom. Position 1 is the
closest to the oven bottom. The racks can be easily removed and arranged
at various levels. For best results with conventional baking, do not use
more than one rack at a time. It is also recommended, when using two
racks, to bake with the racks on positions 2 and 4 or positions 3 and 5.
TTooBBaakkee::
1. Arrange the oven racks in the desired positions BEFORE heating the
oven. If cooking on two racks at the same time, use rack positions 2 and
4 or positions 3 and 5.
2. Turn the Oven Function selector to desired function. Cooking starts
immediately and stops when the Oven Function selector is turned to
OFF.
3. Set the Temperature Control to the desired temperature.
4. Place the food in the oven after the Oven Indicator light goes out.
Position 6
Position 5
Position 4
Position 3
Position 2
Position 1
18
TTWWOOEELLEEMMEENNTTBBAAKKIINNGG//
CCOONNVVEECCTTIIOONNBBAAKKIINNGG//CCOONNVVEECCTTIIOONNCCOOOOKKIINNGG
PPrreehheeaattiinngg
Preheating the oven is not necessary when using temperatures below 250 F.
For best results, it is extremely important that you preheat the oven when
baking cakes and other items that have critical baking temperatures. After
the temperature control has been set, the Oven Indicator light goes out
when the oven reaches that temperature. Preheating takes no longer than
10 -15 minutes. Preheat times will be greater in those areas in which the
electrical supply is less than 240 volts.
TTwwooEElleemmeennttBBaakkiinngg
Conventional baking/roasting is particularly suitable for dishes which require
a high temperature. Many cookbooks contain recipes to be cooked in the
conventional manner. This bake setting is only recommended for single
rack baking.
CCoonnvveeccttiioonnBBaakkiinngg((uuppppeerroovveennoonnllyy))
Convection baking is the process of cooking food with a flow of heated air
circulating throughout the oven cavity. The even circulation of this air
equalizes the temperature throughout the oven cavity and eliminates the
hot and cold spots found in conventional ovens. This feature can make a
significant difference in foods prepared in the oven. A major benefit of
convection baking is the ability to prepare food in quantity. The uniform air
circulation makes this possible . . . a feature not possible in a standard oven.
With this heating system, the air is distributed evenly throughout the oven
by the convection fan. The heat therefore reaches the food to be baked or
roasted more quickly. With this heating method, foods can be baked and
roasted at the same time with minimal taste transfer, even when different
dishes are involved, such as cakes, fish or meat. The hot air system is
especially economical when thawing frozen food.
TTRRUUCCOONNVVEECCttmm((uuppppeerroovveennoonnllyy))
In TruConvectm cooking, the rear element only operates at full power. There
is no direct heat from the bottom or top elements. The heated air is
circulated by the motorized fan in the rear of the oven. Breads, cookies,
and other baked goods come out evenly textured with golden crusts. No
special bakeware is required.